Protein name |
Cell division topological specificity factor 1 |
NCBI Accession ID |
CP000448.1 |
Organism |
Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) |
Left |
410680 |
Right |
410925 |
Strand |
- |
Nucleotide Sequence |
GTGTTGGATTTTTTAAAACGGGTCTTTGCAGACAGTTCCAGCCGTAAGCAAGCCAATGATCGCTTGCGCGTGGTTCTAACTCATGACAGAACCGGCACCTCCTCCCGTTTGATGGAAACCCTGAAAGAAGAAATTTTAGAGGTTATTTCCCGGCATGTAGAAATAGAAGGACGCCCCGAAGTCAAGATAATTCGCGAAGGCCGGCACTCAGCACTGGACATAAACATTCCTTTAAAGGGTAGGTAA |
Sequence |
MLDFLKRVFADSSSRKQANDRLRVVLTHDRTGTSSRLMETLKEEILEVISRHVEIEGRPEVKIIREGRHSALDINIPLKGR |
Source of smORF |
Swiss-Prot |
Function |
Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
Pubmed ID |
21966920
|
Domain |
CDD:412433 |
Functional Category |
Others |
Uniprot ID |
Q0B018
|
ORF Length (Amino Acid) |
81 |