Result : Q0AZF3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000448.1 |
| Organism | Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) |
| Left | 660405 |
| Right | 660626 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAAGCTGAGTTTTGAGCTGGCCCTGAAAAAACTGGAGGAAAGTGTGGAGCAGCTGGAATCAGGTGAGTTGGAACTGGAAGAATCCATCAAGGTTTTTGAGCAAGGTATTGAACTATCCCTTTTTTGTCGTAAGGAACTATCCCAGGCGGAAGGGAAGATTCAACGGCTGGTTAAGAACCTGGGCGGGGAATTTGAACTACTGGATTTTGAAGTGTGA |
| Sequence | MEKLSFELALKKLEESVEQLESGELELEESIKVFEQGIELSLFCRKELSQAEGKIQRLVKNLGGEFELLDFEV |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 21966920 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q0AZF3 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 55
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 660405 | 660626 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 2 | 1453190 | 1453369 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 3 | 3324064 | 3324243 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 4 | 6086610 | 6086828 | + | NZ_CP042806.1 | Terriglobus albidus |
| 5 | 2161777 | 2161959 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 6 | 1778222 | 1778440 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 7 | 2891901 | 2892083 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 8 | 2537866 | 2538051 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 9 | 2330495 | 2330683 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 10 | 1773671 | 1773856 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 11 | 1751015 | 1751233 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 12 | 1643272 | 1643457 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 13 | 2093261 | 2093509 | + | NZ_CP010975.1 | Kangiella geojedonensis |
| 14 | 2104130 | 2104363 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
| 15 | 2940605 | 2940808 | + | NZ_CP061799.1 | Desulfonema limicola |
| 16 | 3285442 | 3285630 | - | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 17 | 2260501 | 2260737 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 18 | 916624 | 916866 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 19 | 4525369 | 4525554 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 20 | 1064014 | 1064193 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 21 | 1576994 | 1577188 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 22 | 5305116 | 5305352 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 23 | 2183749 | 2183928 | + | NZ_AP014879.1 | Sulfuricaulis limicola |
| 24 | 6227711 | 6227896 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 25 | 3172625 | 3172849 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 26 | 5912581 | 5912766 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 27 | 848474 | 848659 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 28 | 5426259 | 5426501 | + | NZ_CP010896.1 | Pseudomonas simiae |
| 29 | 680625 | 680867 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 30 | 643296 | 643538 | - | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 31 | 5096721 | 5096963 | - | NZ_CP012676.1 | Pseudomonas versuta |
| 32 | 1061896 | 1062099 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 33 | 5198325 | 5198510 | + | NZ_CP027723.1 | Pseudomonas orientalis |
| 34 | 5377168 | 5377353 | + | NZ_CP023272.1 | Pseudomonas lurida |
| 35 | 5799717 | 5799959 | + | NZ_CP027756.1 | Pseudomonas synxantha |
| 36 | 6141145 | 6141387 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 37 | 865300 | 865542 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 38 | 5580375 | 5580617 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 39 | 5944356 | 5944538 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 40 | 5782618 | 5782800 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 41 | 5800891 | 5801133 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 42 | 4683818 | 4684000 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 43 | 5265890 | 5266132 | + | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 44 | 6154361 | 6154603 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 45 | 2820898 | 2821119 | + | NZ_CP014262.1 | Pseudomonas corrugata |
| 46 | 5952110 | 5952352 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 47 | 4962886 | 4963128 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 48 | 5997848 | 5998090 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 49 | 3336068 | 3336283 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
| 50 | 6074716 | 6074958 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
| 51 | 6065807 | 6066049 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 52 | 6085563 | 6085805 | + | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 53 | 1129761 | 1130003 | - | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 54 | 2817656 | 2817898 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 55 | 2432907 | 2433140 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011146.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00348.19 | 0.89 | 49 | -3 | same-strand | Polyprenyl synthetase |
| 2 | PF13292.8 | 0.87 | 48 | 991.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 3 | PF02779.26 | 0.85 | 47 | 992.5 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 0.85 | 47 | 992.5 | same-strand | Transketolase, C-terminal domain |
++ More..