Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | CP000448.1 |
Organism | Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) |
Left | 1428999 |
Right | 1429214 |
Strand | - |
Nucleotide Sequence | GTGATTCCGTCTTCCACCAGAGAATTACTCAACATAGCTGATAGTAAATATGCAGTGGTAGTTGCGGTTGCCAAAAGGGCCAGAACCCTTTCCGAGAAGTATAAAGAGGATGAAAACTACCGGCTTTCAACCATGGTAACCCGAGCTTTGGATGAGGTCGTGAATGGTAAAGTAATAATTGAGCCATCAAAAGAAGATGGTTCTCGGGAGGTGTAA |
Sequence | MIPSSTRELLNIADSKYAVVVAVAKRARTLSEKYKEDENYRLSTMVTRALDEVVNGKVIIEPSKEDGSREV |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | 21966920 |
Domain | |
Functional Category | Others |
Uniprot ID | Q0AXK9 |
ORF Length (Amino Acid) | 71 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1428999 | 1429214 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
2 | 888185 | 888382 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
3 | 1796116 | 1796289 | + | NZ_CP045875.1 | Heliorestis convoluta |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00551.21 | 1.0 | 3 | 5513 | same-strand | Formyl transferase |
2 | PF02911.20 | 1.0 | 3 | 5513 | same-strand | Formyl transferase, C-terminal domain |
3 | PF01327.23 | 1.0 | 3 | 5042 | same-strand | Polypeptide deformylase |
4 | PF17764.3 | 1.0 | 3 | 2688 | same-strand | 3'DNA-binding domain (3'BD) |
5 | PF18074.3 | 1.0 | 3 | 2688 | same-strand | Primosomal protein N C-terminal domain |
6 | PF00270.31 | 1.0 | 3 | 2688 | same-strand | DEAD/DEAH box helicase |
7 | PF04851.17 | 1.0 | 3 | 2688 | same-strand | Type III restriction enzyme, res subunit |
8 | PF18319.3 | 1.0 | 3 | 2688 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
9 | PF02773.18 | 1.0 | 3 | 1325 | same-strand | S-adenosylmethionine synthetase, C-terminal domain |
10 | PF02772.18 | 1.0 | 3 | 1325 | same-strand | S-adenosylmethionine synthetase, central domain |
11 | PF00438.22 | 1.0 | 3 | 1325 | same-strand | S-adenosylmethionine synthetase, N-terminal domain |
12 | PF04127.17 | 1.0 | 3 | 3 | same-strand | DNA / pantothenate metabolism flavoprotein |
13 | PF02441.21 | 1.0 | 3 | 3 | same-strand | Flavoprotein |
14 | PF00625.23 | 1.0 | 3 | 7 | same-strand | Guanylate kinase |
15 | PF04025.14 | 1.0 | 3 | 618 | same-strand | Domain of unknown function (DUF370) |
16 | PF03755.15 | 1.0 | 3 | 915 | same-strand | YicC-like family, N-terminal region |
17 | PF08340.13 | 1.0 | 3 | 915 | same-strand | Domain of unknown function (DUF1732) |
18 | PF00122.22 | 0.67 | 2 | 2448.0 | same-strand | E1-E2 ATPase |
19 | PF00689.23 | 0.67 | 2 | 2448.0 | same-strand | Cation transporting ATPase, C-terminus |
20 | PF00702.28 | 0.67 | 2 | 2448.0 | same-strand | haloacid dehalogenase-like hydrolase |
21 | PF13246.8 | 0.67 | 2 | 2448.0 | same-strand | Cation transport ATPase (P-type) |
22 | PF00690.28 | 0.67 | 2 | 2448.0 | same-strand | Cation transporter/ATPase, N-terminus |
23 | PF01678.21 | 0.67 | 2 | 2602.5 | same-strand | Diaminopimelate epimerase |
24 | PF13238.8 | 0.67 | 2 | 25.0 | same-strand | AAA domain |