Result : Q0AWL5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000448.1 |
| Organism | Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) |
| Left | 1809005 |
| Right | 1809271 |
| Strand | + |
| Nucleotide Sequence | GTGGCCAAAAGTAAAACCCCCGCCAAAAGAGCCCGCAGGGCAGAAGCCAACCGGCTCAGAAATAAAGCTTATAAAAGTAAGCTGAAAACGGCAATAAAGAATTATGAAAATGCAATAATTGCGGAGGATTTGGATACAGCCAGCAACAAACTGTTGCAGGTAACCTCCCTTTTAGATAGGAGCATCACCAAAGGAATACTTCATAAGAATAATGTAGCCAGAAAAAAATCAGCTTTGAGTAAAAAGCTGAATAGTATTAGCCAGTAA |
| Sequence | MAKSKTPAKRARRAEANRLRNKAYKSKLKTAIKNYENAIIAEDLDTASNKLLQVTSLLDRSITKGILHKNNVARKKSALSKKLNSISQ |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 21966920 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q0AWL5 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1809005 | 1809271 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 2 | 1724428 | 1724700 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008346.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06969.18 | 1.0 | 2 | 4900.5 | opposite-strand | HemN C-terminal domain |
| 2 | PF04055.23 | 1.0 | 2 | 4900.5 | opposite-strand | Radical SAM superfamily |
| 3 | PF00009.29 | 1.0 | 2 | 3041.5 | opposite-strand | Elongation factor Tu GTP binding domain |
| 4 | PF06421.14 | 1.0 | 2 | 3041.5 | opposite-strand | GTP-binding protein LepA C-terminus |
| 5 | PF00679.26 | 1.0 | 2 | 3041.5 | opposite-strand | Elongation factor G C-terminus |
| 6 | PF03144.27 | 1.0 | 2 | 3041.5 | opposite-strand | Elongation factor Tu domain 2 |
| 7 | PF01926.25 | 1.0 | 2 | 3041.5 | opposite-strand | 50S ribosome-binding GTPase |
| 8 | PF10662.11 | 1.0 | 2 | 3041.5 | opposite-strand | Ethanolamine utilisation - propanediol utilisation |
| 9 | PF14492.8 | 1.0 | 2 | 3041.5 | opposite-strand | Elongation Factor G, domain III |
| 10 | PF07454.13 | 1.0 | 2 | 525.0 | opposite-strand | Stage II sporulation protein P (SpoIIP) |
| 11 | PF06144.15 | 1.0 | 2 | 2461.0 | opposite-strand | DNA polymerase III, delta subunit |
++ More..