Result : Q0ATX6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | CP000448.1 |
| Organism | Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) |
| Left | 2896927 |
| Right | 2897220 |
| Strand | - |
| Nucleotide Sequence | ATGCGCACATACGAAATGATGTTTGTCCTCAGACCTGATTTGGAAGAAGAACAAGTTTTGGAAACCAAAGAAAGACTGCAGAAGATCATAGCCGATTTTGGCGGTGAATTCATTAATGCAGCAGACGGGTGGGGCAAAAAACGACTTGCCTATGCCATTGACGATTATGTAGAAGGTATTTATAGCCTGTGGTATTTCAAAGGCAAGCCGGAAACTGTCGATGAATTGGACAGGATTATCAAAATTTCGGAGAACTTTTTGCGCCACATCATTATTCGCCAGGATGAAAAATAA |
| Sequence | MRTYEMMFVLRPDLEEEQVLETKERLQKIIADFGGEFINAADGWGKKRLAYAIDDYVEGIYSLWYFKGKPETVDELDRIIKISENFLRHIIIRQDEK |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 21966920 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q0ATX6 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2896927 | 2897220 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 2 | 2371596 | 2371889 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 3 | 2566251 | 2566538 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008346.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03948.16 | 0.67 | 2 | 1742.5 | same-strand | Ribosomal protein L9, C-terminal domain |
| 2 | PF01281.21 | 0.67 | 2 | 1742.5 | same-strand | Ribosomal protein L9, N-terminal domain |
| 3 | PF09991.11 | 0.67 | 2 | 1346.0 | same-strand | Predicted membrane protein (DUF2232) |
| 4 | PF12643.9 | 0.67 | 2 | 1025.5 | same-strand | MazG-like family |
| 5 | PF01084.22 | 1.0 | 3 | 479 | same-strand | Ribosomal protein S18 |
| 6 | PF00436.27 | 1.0 | 3 | 36 | same-strand | Single-strand binding protein family |
| 7 | PF06107.13 | 1.0 | 3 | 554 | same-strand | Bacterial protein of unknown function (DUF951) |
| 8 | PF02769.24 | 0.67 | 2 | 1441.5 | same-strand | AIR synthase related protein, C-terminal domain |
| 9 | PF00586.26 | 0.67 | 2 | 1441.5 | same-strand | AIR synthase related protein, N-terminal domain |
++ More..