Result : A6VL34
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable oxaloacetate decarboxylase gamma chain (EC 7.2.4.2) |
| NCBI Accession ID | CP000746.1 |
| Organism | Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / 130Z) |
| Left | 342579 |
| Right | 342848 |
| Strand | - |
| Nucleotide Sequence | ATGACTCCAGCAGAACTCTTTGGTGAAGGGATTAACCTGATGCTTTCAGGTATGGGTTTCGTTATTACGTTTTTGCTCATTTTAATTTGGGCAATCACTACGATGTCAAAACTCATTAACCGCTTTTTCCCCGAACCCGTTAAACAATCTAAACCTTCGCAAAAACCGACCGCACTTTCCGCTGCGGTACAAGGAAATGATTTAGATCGTTTACGTCCCGTTATCGTGGCGGCTATCGCCCATCATCGCCGTTCTCAAGGCTTAAATTAA |
| Sequence | MTPAELFGEGINLMLSGMGFVITFLLILIWAITTMSKLINRFFPEPVKQSKPSQKPTALSAAVQGNDLDRLRPVIVAAIAHHRRSQGLN |
| Source of smORF | Swiss-Prot |
| Function | Catalyzes the decarboxylation of oxaloacetate coupled to Na(+) translocation. {ECO:0000255|HAMAP-Rule:MF_00404}. |
| Pubmed ID | 21118570 |
| Domain | CDD:412911 |
| Functional Category | Others |
| Uniprot ID | A6VL34 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1946312 | 1946578 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 2 | 1658031 | 1658297 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 3 | 1504911 | 1505177 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 4 | 38391 | 38657 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 5 | 2342161 | 2342418 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 6 | 322236 | 322490 | + | NZ_LR134167.1 | Avibacterium volantium |
| 7 | 920772 | 921029 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 8 | 2401241 | 2401498 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 9 | 2107231 | 2107488 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 10 | 1077688 | 1077939 | - | NZ_CP028926.1 | Pasteurella multocida |
| 11 | 1611386 | 1611643 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 12 | 1868159 | 1868410 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 13 | 426640 | 426897 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 14 | 205741 | 205995 | + | NZ_CP046531.1 | Mannheimia ovis |
| 15 | 487834 | 488088 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 16 | 1767083 | 1767355 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 17 | 168584 | 168844 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 18 | 824781 | 825035 | - | NZ_CP061280.1 | Mannheimia bovis |
| 19 | 405054 | 405314 | - | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 20 | 630822 | 631085 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 21 | 204066 | 204323 | + | NZ_CP018804.1 | Histophilus somni |
| 22 | 3563164 | 3563412 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 23 | 4296994 | 4297242 | + | NZ_CP028271.1 | Mixta intestinalis |
| 24 | 829871 | 830116 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 25 | 3521844 | 3522098 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 26 | 5168491 | 5168739 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 27 | 574607 | 574858 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 28 | 5067069 | 5067317 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 29 | 5885232 | 5885483 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 30 | 4431970 | 4432218 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 31 | 783281 | 783532 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 32 | 4711547 | 4711798 | + | NZ_CP054254.1 | Klebsiella variicola |
| 33 | 4381774 | 4382022 | + | NZ_LR134475.1 | Klebsiella aerogenes |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015031.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03977.15 | 0.93 | 28 | 1830 | same-strand | Na+-transporting oxaloacetate decarboxylase beta subunit |
| 2 | PF00682.21 | 1.0 | 30 | 16.0 | same-strand | HMGL-like |
| 3 | PF02436.20 | 0.97 | 29 | 16.0 | same-strand | Conserved carboxylase domain |
| 4 | PF00364.24 | 0.97 | 29 | 16.0 | same-strand | Biotin-requiring enzyme |
| 5 | PF13533.8 | 0.67 | 20 | 16 | same-strand | Biotin-lipoyl like |
++ More..