Result : Q09T02
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Lantibiotic michiganin-A |
| NCBI Accession ID | DQ458780.1 |
| Organism | Clavibacter michiganensis subsp. michiganensis |
| Left | 164 |
| Right | 370 |
| Strand | + |
| Nucleotide Sequence | ATGAACGACATCCTCGAGACGGAGACCCCCGTCATGGTCAGCCCCCGGTGGGACATGCTGCTCGACGCGGGCGAGGACACCAGCCCGTCCGTCCAGACCCAGATCGACGCGGAGTTCCGTCGCGTCGTGAGCCCGTACATGTCCAGCAGCGGCTGGCTCTGCACGCTCACCATCGAATGTGGCACCATCATCTGCGCGTGTCGCTGA |
| Sequence | MNDILETETPVMVSPRWDMLLDAGEDTSPSVQTQIDAEFRRVVSPYMSSSGWLCTLTIECGTIICACR |
| Source of smORF | Swiss-Prot |
| Function | Lanthionine-containing peptide antibiotic (lantibiotic) active against S.michiganensis subspecies sepedonicus strain 2136 (MIC=30 pmol/ml). The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. {ECO:0000269|Pubmed:16957199}. |
| Pubmed ID | 16957199 |
| Domain | |
| Functional Category | Antimicrobial |
| Uniprot ID | Q09T02 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2190046 | 2190252 | + | NZ_CP033724.1 | Clavibacter michiganensis subsp. michiganensis |
| 2 | 2830295 | 2830498 | + | NZ_CP015515.1 | Rathayibacter tritici |
| 3 | 3103104 | 3103307 | - | NZ_CP028130.1 | Rathayibacter iranicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015515.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12730.9 | 1.0 | 3 | 4036.5 | opposite-strand | ABC-2 family transporter protein |
| 2 | PF00005.29 | 1.0 | 3 | 2420 | opposite-strand | ABC transporter |
| 3 | PF00072.26 | 1.0 | 3 | 1533 | opposite-strand | Response regulator receiver domain |
| 4 | PF00196.21 | 1.0 | 3 | 1533 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 5 | PF08281.14 | 1.0 | 3 | 1533 | opposite-strand | Sigma-70, region 4 |
| 6 | PF07730.15 | 1.0 | 3 | 400 | opposite-strand | Histidine kinase |
| 7 | PF13575.8 | 1.0 | 3 | 88 | same-strand | Domain of unknown function (DUF4135) |
| 8 | PF05147.15 | 1.0 | 3 | 88 | same-strand | Lanthionine synthetase C-like protein |
| 9 | PF10727.11 | 0.67 | 2 | 3294.0 | opposite-strand | Rossmann-like domain |
| 10 | PF03807.19 | 0.67 | 2 | 3294.0 | opposite-strand | NADP oxidoreductase coenzyme F420-dependent |
| 11 | PF03703.16 | 0.67 | 2 | 4754.0 | opposite-strand | Bacterial PH domain |
| 12 | PF11377.10 | 0.67 | 2 | 6121.0 | opposite-strand | Protein of unknown function (DUF3180) |
++ More..