Protein Information |
Information Type | Description |
---|---|
Protein name | Lanthionine-containing peptide SapB (Morphogen SapB) (Rapid aerial mycelium protein S) (Spore-associated protein B) |
NCBI Accession ID | AB006206.3 |
Organism | Streptomyces griseus |
Left | 7096 |
Right | 7227 |
Strand | - |
Nucleotide Sequence | ATGGCGCTTCTCGACCTTCAGGCGATGGACACCCCGGCCGAGGACTCCTTCGGCGAGCTCCGCACGGGCAGCCAGGTCTCGCTGCTGGTCTGTGAGTACAGCTCGCTCAGCGTGGTCCTCTGCACCCCGTGA |
Sequence | MALLDLQAMDTPAEDSFGELRTGSQVSLLVCEYSSLSVVLCTP |
Source of smORF | Swiss-Prot |
Function | Lanthionine-containing peptide devoid of antibiotic properties, involved in the formation of aerial mycelium. Suggested to self-assemble at air-water interfaces, thus providing a film of surfactant through which nascent aerial hyphae can emerge. The aerial hyphae differentiate further into spores (By similarity). {ECO:0000250}. |
Pubmed ID | 8458843 |
Domain | CDD:411103 |
Functional Category | Others |
Uniprot ID | Q07642 |
ORF Length (Amino Acid) | 43 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2826654 | 2826785 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
2 | 5455588 | 5455719 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
3 | 5429784 | 5429915 | + | NZ_CP070242.1 | Streptomyces californicus |
4 | 5312500 | 5312631 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
5 | 5457085 | 5457216 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
6 | 5107054 | 5107185 | + | NZ_CP024957.1 | Streptomyces cavourensis |
7 | 5503571 | 5503702 | + | NZ_CP020563.1 | Kitasatospora albolonga |
8 | 2723067 | 2723198 | - | NC_020990.1 | Streptomyces albidoflavus |
9 | 3136950 | 3137081 | - | NZ_CP031742.1 | Streptomyces koyangensis |
10 | 6374686 | 6374814 | + | NZ_CP034279.1 | Streptomyces ficellus |
11 | 2846995 | 2847123 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
12 | 5413669 | 5413803 | + | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
13 | 1063456 | 1063587 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
14 | 6172810 | 6172938 | + | NZ_CP015866.1 | Streptomyces parvulus |
15 | 129860 | 129988 | + | NZ_CP023408.1 | Streptomyces fungicidicus |
16 | 6718375 | 6718503 | - | NZ_CP029196.1 | Streptomyces venezuelae |
17 | 6829925 | 6830053 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
18 | 721355 | 721483 | + | NZ_CP019457.1 | Streptomyces lydicus |
19 | 278194 | 278322 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
20 | 693260 | 693388 | - | NZ_CP023691.1 | Streptomyces platensis |
21 | 2782263 | 2782382 | + | NZ_CP045309.1 | Micromonospora terminaliae |
22 | 2782081 | 2782200 | + | NZ_CP045309.1 | Micromonospora terminaliae |
23 | 216334 | 216459 | + | NZ_CP031194.1 | Streptomyces paludis |
24 | 89414 | 89545 | + | NZ_CP029254.1 | Streptomyces spongiicola |
25 | 6538911 | 6539048 | + | NZ_CP023701.1 | Streptomyces subrutilus |
26 | 1052824 | 1052958 | - | NZ_CP023692.1 | Streptomyces vinaceus |
27 | 6588427 | 6588540 | + | NZ_CP023688.1 | Streptomyces rimosus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00196.21 | 0.96 | 25 | 3939.5 | opposite-strand | Bacterial regulatory proteins, luxR family |
2 | PF00005.29 | 1.0 | 26 | 1815 | same-strand | ABC transporter |
3 | PF00664.25 | 1.0 | 26 | 147.5 | same-strand | ABC transporter transmembrane region |