| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Pyocin-S1 immunity protein |
| NCBI Accession ID | D12707.1 |
| Organism | Pseudomonas aeruginosa |
| Left | 2228 |
| Right | 2491 |
| Strand | + |
| Nucleotide Sequence | ATGAAGTCCAAGATTTCCGAATATACGGAAAAAGAGTTTCTTGAGTTTGTTGAAGACATATACACAAACAATAAGAAAAAGTTCCCTACCGAGGAGTCTCATATTCAAGCCGTGCTTGAATTTAAAAAACTAACGGAACACCCAAGCGGCTCAGACCTTCTTTACTACCCCAACGAAAATAGAGAAGATAGCCCAGCTGGAGTTGTAAAGGAAGTTAAAGAATGGCGTGCTTCCAAGGGGCTTCCTGGCTTTAAGGCCGGTTAG |
| Sequence | MKSKISEYTEKEFLEFVEDIYTNNKKKFPTEESHIQAVLEFKKLTEHPSGSDLLYYPNENREDSPAGVVKEVKEWRASKGLPGFKAG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl03164. Profile Description: inhibitory immunity (Im) protein of colicin (Col) deoxyribonuclease (DNase) and pyocins. This family contains inhibitory immunity (Im) proteins that bind to colicin endonucleases (DNases) or pyocins with very high affinity and specificity; this is critical for the neutralization of endogenous DNase catalytic activity and for protection against exogenous DNase bacteriocins. The DNase colicin family (ColE2, ColE7, ColE8 and ColE9) in E. coli, and pyocin family (S1, S2, S3 and AP41) in P. aeruginosa, are potent bacteriocins where the immunity proteins (Ims) protect the colicin/pyocin producing (i.e. colicinogenic) bacteria by binding and inactivating colicin nucleases. The binding affinities between cognate and non-cognate nucleases by Im proteins can vary up to 10 orders of magnitude. |
| Pubmed ID | 8491711 |
| Domain | CDD:413614 |
| Functional Category | Others |
| Uniprot ID | Q06578 |
| ORF Length (Amino Acid) | 87 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1245665 | 1245928 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 2865528 | 2865743 | - | NZ_CP065640.1 | Serratia rubidaea |
| 3 | 4501632 | 4501886 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 4 | 2992239 | 2992493 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 5 | 2718014 | 2718229 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 6 | 2717662 | 2717913 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 7 | 6203473 | 6203685 | - | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 8 | 6203135 | 6203347 | - | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 9 | 4393467 | 4393721 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 10 | 1806263 | 1806517 | + | NZ_CP007230.1 | Yersinia similis |
| 11 | 4389673 | 4389915 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 12 | 2248062 | 2248316 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 13 | 1663801 | 1664055 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 14 | 601839 | 602099 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 15 | 2487150 | 2487407 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 16 | 5095 | 5310 | + | NC_010693.1 | Erwinia tasmaniensis Et1/99 |
| 17 | 529303 | 529557 | - | NC_015968.1 | Enterobacter soli |
| 18 | 529661 | 529909 | - | NC_015968.1 | Enterobacter soli |
| 19 | 529977 | 530225 | - | NC_015968.1 | Enterobacter soli |
| 20 | 3849223 | 3849480 | - | NZ_CP028271.1 | Mixta intestinalis |
| 21 | 3850323 | 3850580 | - | NZ_CP028271.1 | Mixta intestinalis |
| 22 | 3849771 | 3850028 | - | NZ_CP028271.1 | Mixta intestinalis |
| 23 | 4505008 | 4505262 | - | NZ_CP046293.1 | Yersinia intermedia |
| 24 | 4621242 | 4621502 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 25 | 4225394 | 4225654 | - | NZ_CP029736.1 | Providencia rettgeri |
| 26 | 2197515 | 2197775 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 27 | 2105090 | 2105353 | - | NZ_CP062158.2 | Pseudomonas lundensis |
| 28 | 4101413 | 4101667 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 29 | 2796920 | 2797180 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 30 | 4218604 | 4218852 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 31 | 261600 | 261824 | - | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06958.14 | 0.76 | 19 | 45.5 | same-strand | S-type Pyocin |