Protein Information |
Information Type | Description |
---|---|
Protein name | Acyl carrier protein (ACP) |
NCBI Accession ID | CP000263.1 |
Organism | Buchnera aphidicola subsp. Cinara cedri (strain Cc) |
Left | 250714 |
Right | 250956 |
Strand | + |
Nucleotide Sequence | ATGAAAAATATCAACTATCGTGTAAAAAAAATAATTGCAAAACAATTTCAAATTAATATTAAAAAAATTTCATTAAATAATAATTTAAAAAATGATTTAAAAATTGATTCATTAGATTTTGTAGAATTAATTATGTTATTAGAAGAAGAATTTAACATTAAATTATTTGATATTGAAGCGGAAAAAATAAAAAAAATTAAAGATATAATTCCGTATATAAAAAAAAAAAAACTAAAAGAATAA |
Sequence | MKNINYRVKKIIAKQFQINIKKISLNNNLKNDLKIDSLDFVELIMLLEEEFNIKLFDIEAEKIKKIKDIIPYIKKKKLKE |
Source of smORF | Swiss-Prot |
Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01217}. |
Pubmed ID | 17038625 |
Domain | |
Functional Category | Others |
Uniprot ID | Q057L2 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 157707 | 157943 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
2 | 1520912 | 1521136 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
3 | 1964459 | 1964656 | - | NZ_CP025197.1 | Acetivibrio saccincola |
4 | 1933713 | 1933940 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
5 | 141921 | 142163 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02504.17 | 0.8 | 4 | 2880.0 | same-strand | Fatty acid synthesis protein |
2 | PF08541.12 | 0.8 | 4 | 1857.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
3 | PF08545.12 | 0.8 | 4 | 1857.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
4 | PF00698.23 | 0.8 | 4 | 877.0 | same-strand | Acyl transferase domain |
5 | PF13561.8 | 0.8 | 4 | 95.0 | same-strand | Enoyl-(Acyl carrier protein) reductase |
6 | PF00106.27 | 0.8 | 4 | 95.0 | same-strand | short chain dehydrogenase |
7 | PF08659.12 | 0.8 | 4 | 95.0 | same-strand | KR domain |
8 | PF00109.28 | 0.8 | 4 | 139.5 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
9 | PF02801.24 | 0.8 | 4 | 139.5 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
10 | PF14622.8 | 0.8 | 4 | 1471.5 | same-strand | Ribonuclease-III-like |
11 | PF00636.28 | 0.8 | 4 | 1471.5 | same-strand | Ribonuclease III domain |
12 | PF00035.28 | 0.8 | 4 | 1471.5 | same-strand | Double-stranded RNA binding motif |
13 | PF04055.23 | 0.8 | 4 | 2309.0 | same-strand | Radical SAM superfamily |
14 | PF16199.7 | 0.8 | 4 | 2309.0 | same-strand | Radical SAM C-terminal domain |
15 | PF04232.14 | 0.6 | 3 | 3643 | same-strand | Stage V sporulation protein S (SpoVS) |