Result : Q057L2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein (ACP) |
| NCBI Accession ID | CP000263.1 |
| Organism | Buchnera aphidicola subsp. Cinara cedri (strain Cc) |
| Left | 250714 |
| Right | 250956 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAATATCAACTATCGTGTAAAAAAAATAATTGCAAAACAATTTCAAATTAATATTAAAAAAATTTCATTAAATAATAATTTAAAAAATGATTTAAAAATTGATTCATTAGATTTTGTAGAATTAATTATGTTATTAGAAGAAGAATTTAACATTAAATTATTTGATATTGAAGCGGAAAAAATAAAAAAAATTAAAGATATAATTCCGTATATAAAAAAAAAAAAACTAAAAGAATAA |
| Sequence | MKNINYRVKKIIAKQFQINIKKISLNNNLKNDLKIDSLDFVELIMLLEEEFNIKLFDIEAEKIKKIKDIIPYIKKKKLKE |
| Source of smORF | Swiss-Prot |
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01217}. |
| Pubmed ID | 17038625 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q057L2 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 157707 | 157943 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 2 | 1520912 | 1521136 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 3 | 1964459 | 1964656 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 4 | 1933713 | 1933940 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 5 | 141921 | 142163 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016502.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02504.17 | 0.8 | 4 | 2880.0 | same-strand | Fatty acid synthesis protein |
| 2 | PF08541.12 | 0.8 | 4 | 1857.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 3 | PF08545.12 | 0.8 | 4 | 1857.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
| 4 | PF00698.23 | 0.8 | 4 | 877.0 | same-strand | Acyl transferase domain |
| 5 | PF13561.8 | 0.8 | 4 | 95.0 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 6 | PF00106.27 | 0.8 | 4 | 95.0 | same-strand | short chain dehydrogenase |
| 7 | PF08659.12 | 0.8 | 4 | 95.0 | same-strand | KR domain |
| 8 | PF00109.28 | 0.8 | 4 | 139.5 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 9 | PF02801.24 | 0.8 | 4 | 139.5 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 10 | PF14622.8 | 0.8 | 4 | 1471.5 | same-strand | Ribonuclease-III-like |
| 11 | PF00636.28 | 0.8 | 4 | 1471.5 | same-strand | Ribonuclease III domain |
| 12 | PF00035.28 | 0.8 | 4 | 1471.5 | same-strand | Double-stranded RNA binding motif |
| 13 | PF04055.23 | 0.8 | 4 | 2309.0 | same-strand | Radical SAM superfamily |
| 14 | PF16199.7 | 0.8 | 4 | 2309.0 | same-strand | Radical SAM C-terminal domain |
| 15 | PF04232.14 | 0.6 | 3 | 3643 | same-strand | Stage V sporulation protein S (SpoVS) |
++ More..