ProsmORF-pred
Result : Q057I5
Protein Information
Information Type Description
Protein name 30S ribosomal protein S16
NCBI Accession ID CP000263.1
Organism Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Left 281409
Right 281675
Strand +
Nucleotide Sequence ATGATCAAAATAAGATTATCTAGACATGGAATGAAAAAAAAACCATTTTATCAAATAATTATAGCTAATGTAAGATCCTCTAGAAATGGTAAATTTATTGAACGCGTTGGATTTTTTAATCCTTTTGCCAAAAAAAATGAAGAAAAAATACGAATTTCAACTAAAAGAATACAATATTGGTTAGAAAAAGGAGCTAAAAAAACGAATAGAATTAAAAATTTATTAATACAATTTAAAAAAATATCATCAAATAACATTAAAATATAA
Sequence MIKIRLSRHGMKKKPFYQIIIANVRSSRNGKFIERVGFFNPFAKKNEEKIRISTKRIQYWLEKGAKKTNRIKNLLIQFKKISSNNIKI
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Pubmed ID 17038625
Domain CDD:412339
Functional Category Ribosomal_protein
Uniprot ID Q057I5
ORF Length (Amino Acid) 88
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 118
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1369690 1369926 + NZ_CP021425.1 Oleiphilus messinensis
2 148578 148826 - NZ_LS483443.1 Aggregatibacter segnis ATCC 33393
3 874601 874849 + NZ_CP009610.1 Haemophilus influenzae
4 963832 964080 + NZ_LS483429.1 Haemophilus aegyptius
5 3690913 3691161 - NZ_CP041660.1 Catenovulum sediminis
6 2928240 2928482 - NZ_CP031416.1 Gallaecimonas mangrovi
7 503980 504231 + NZ_CP043869.1 Neptunomonas concharum
8 845561 845800 + NZ_AP018724.1 Sulfurivermis fontis
9 313607 313855 + NZ_CP018804.1 Histophilus somni
10 636755 637003 - NZ_CP042941.1 Atlantibacter hermannii
11 1667701 1667952 + NC_010995.1 Cellvibrio japonicus Ueda107
12 3257054 3257302 - NZ_CP012257.1 Cronobacter universalis NCTC 9529
13 5099258 5099506 - NZ_CP040428.1 Jejubacter calystegiae
14 1591246 1591509 + NZ_CP007031.1 Marichromatium purpuratum 984
15 2355045 2355317 - NC_019940.1 Thioflavicoccus mobilis 8321
16 1260815 1261075 + NZ_CP050508.1 Raoultella terrigena
17 129725 129973 + NZ_CP027107.1 Cronobacter sakazakii
18 862626 862874 + NZ_CP013940.1 Cronobacter malonaticus LMG 23826
19 668592 668840 + NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
20 3389518 3389766 - NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
21 574175 574426 + NZ_CP015839.1 Marinobacterium aestuarii
22 2808864 2809124 - NC_013851.1 Allochromatium vinosum DSM 180
23 872796 873041 + NC_013166.1 Kangiella koreensis DSM 16069
24 397949 398203 + NC_002977.6 Methylococcus capsulatus str. Bath
25 1548771 1549019 + NC_007912.1 Saccharophagus degradans 2-40
26 4695719 4695982 + NC_018012.1 Thiocystis violascens DSM 198
27 4131077 4131325 - NZ_CP060092.1 Teredinibacter purpureus
28 5044573 5044821 - NZ_CP020388.1 Pluralibacter gergoviae
29 1706491 1706739 - NZ_LT906448.1 Pasteurella dagmatis
30 2380968 2381219 - NZ_CP011797.1 Reinekea forsetii
31 1286493 1286741 - NZ_AP019007.1 Enterobacter oligotrophicus
32 792366 792611 + NZ_CP025120.1 Kangiella profundi
33 4883910 4884170 - NZ_CP048878.1 Spartinivicinus ruber
34 1040223 1040471 + NZ_CP054058.1 Scandinavium goeteborgense
35 1173841 1174089 + NZ_CP041247.1 Raoultella electrica
36 470623 470871 - NZ_CP026047.1 Raoultella planticola
37 1223189 1223437 + NZ_CP046672.1 Raoultella ornithinolytica
38 3558162 3558410 - NZ_CP027986.1 Enterobacter sichuanensis
39 3583374 3583622 - NZ_CP017184.1 Enterobacter roggenkampii
40 3561717 3561965 - NC_015968.1 Enterobacter soli
41 3685843 3686091 + NZ_CP025034.2 Enterobacter sp. SGAir0187
42 3661859 3662107 - NZ_CP009756.1 Enterobacter cloacae
43 4841529 4841777 + NZ_CP045769.1 Enterobacter cancerogenus
44 3868906 3869154 - NZ_CP043318.1 Enterobacter chengduensis
45 1456164 1456412 + NZ_CP036175.1 Klebsiella huaxiensis
46 3550837 3551085 - NZ_AP022508.1 Enterobacter bugandensis
47 1187814 1188062 + NZ_CP013990.1 Leclercia adecarboxylata
48 4838119 4838367 + NZ_CP017279.1 Enterobacter ludwigii
49 15320 15568 + NZ_CP015031.1 Basfia succiniciproducens
50 410569 410817 + NC_006300.1 [Mannheimia] succiniciproducens MBEL55E
51 3371537 3371785 + NZ_CP019343.1 Oceanicoccus sagamiensis
52 3521806 3522054 - NZ_CP012871.1 [Enterobacter] lignolyticus
53 1929985 1930242 - NZ_CP039268.1 Thermochromatium tepidum ATCC 43061
54 1217545 1217793 + NZ_CP065838.1 Klebsiella quasipneumoniae
55 4086971 4087219 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
56 1706384 1706632 - NZ_CP012418.1 Kangiella sediminilitoris
57 4305676 4305924 + NZ_CP016337.1 Kosakonia sacchari
58 3672458 3672706 - NZ_CP063425.1 Kosakonia pseudosacchari
59 1212895 1213143 + NZ_CP054254.1 Klebsiella variicola
60 2441018 2441263 - NZ_AP014936.1 Sulfurifustis variabilis
61 1178480 1178728 + NZ_LR134475.1 Klebsiella aerogenes
62 903635 903883 + NC_013961.1 Erwinia amylovora CFBP1430
63 2961740 2961988 - NC_010694.1 Erwinia tasmaniensis Et1/99
64 927880 928128 + NZ_CP023567.1 Erwinia pyrifoliae
65 805857 806105 - NZ_LS483458.1 Haemophilus haemolyticus
66 1369546 1369794 + NZ_CP060111.1 Klebsiella michiganensis
67 668134 668382 - NZ_CP014056.2 Grimontia hollisae
68 1438006 1438257 + NZ_CP046378.1 Shewanella algae
69 2762661 2762912 - NC_020888.1 Thalassolituus oleivorans MIL-1
70 2702401 2702649 - NC_013716.1 Citrobacter rodentium ICC168
71 1031584 1031832 + NZ_CP061527.1 Shigella dysenteriae
72 4029248 4029496 + NZ_CP057657.1 Escherichia fergusonii
73 2744588 2744836 - NC_004337.2 Shigella flexneri 2a str. 301
74 2745937 2746185 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
75 2715038 2715286 - NZ_AP014857.1 Escherichia albertii
76 3466190 3466438 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
77 1197955 1198203 - NZ_LR134510.1 Actinobacillus delphinicola
78 3266214 3266462 - NZ_LR134340.1 Escherichia marmotae
79 1047517 1047765 + NZ_LT906463.1 Haemophilus pittmaniae
80 1303295 1303543 + NZ_CP014007.2 Kosakonia oryzae
81 3862524 3862772 - NZ_CP015113.1 Kosakonia radicincitans
82 22608 22856 - NZ_LR134167.1 Avibacterium volantium
83 3668264 3668512 + NZ_CP044098.1 Citrobacter portucalensis
84 1437465 1437713 - NZ_CP033744.1 Citrobacter freundii
85 2816643 2816891 - NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
86 2928734 2928997 - NZ_AP017928.1 Methylocaldum marinum
87 3318020 3318268 - NZ_CP012264.1 Cronobacter condimenti 1330
88 3663346 3663594 - NC_009792.1 Citrobacter koseri ATCC BAA-895
89 4630128 4630376 + NZ_CP038469.1 Citrobacter tructae
90 4348058 4348306 + NZ_CP045300.1 Kosakonia arachidis
91 1097495 1097743 + NZ_CP035129.1 Kosakonia cowanii
92 783351 783599 - NZ_CP028926.1 Pasteurella multocida
93 1202892 1203140 - NZ_CP040863.1 Rodentibacter heylii
94 1475422 1475661 + NZ_CP014864.1 Microbulbifer thermotolerans
95 1673621 1673869 + NZ_CP014544.1 Zhongshania aliphaticivorans
96 1306509 1306757 + NZ_CP022358.1 Shewanella bicestrii
97 1036066 1036314 + NZ_CP048796.1 Providencia vermicola
98 418482 418721 + NZ_AP014545.1 Amphritea japonica ATCC BAA-1530
99 1008837 1009079 + NZ_CP031093.1 Hydrocarboniclastica marina
100 3552712 3552951 - NZ_CP014143.1 Microbulbifer aggregans
101 1100689 1100937 + NZ_CP011041.1 Pseudoalteromonas tetraodonis
102 1086900 1087148 + NZ_CP011030.1 Pseudoalteromonas issachenkonii
103 1856451 1856699 - NC_006512.1 Idiomarina loihiensis L2TR
104 4472962 4473210 + NZ_CP028897.1 Dongshaea marina
105 918937 919194 + NZ_CP051183.1 Bermanella marisrubri
106 4626608 4626856 - NZ_CP020038.1 Agarilytica rhodophyticola
107 589190 589438 + NZ_CP031961.1 Pseudoalteromonas tunicata
108 974005 974253 + NC_007481.1 Pseudoalteromonas translucida
109 1038192 1038440 + NZ_CP011036.1 Pseudoalteromonas nigrifaciens
110 4462092 4462340 - NZ_CP019628.1 Pseudoalteromonas aliena
111 686953 687201 - NZ_CP072133.1 Pseudoalteromonas xiamenensis
112 1968708 1968956 - NZ_CP016605.1 Bisgaardia hudsonensis
113 2765777 2766025 - NZ_CP011025.1 Pseudoalteromonas arctica A 37-1-2
114 2615728 2615976 - NZ_CP027523.1 Pseudoalteromonas carrageenovora
115 705720 705968 + NZ_CP050851.1 Aeromonas hydrophila
116 3371046 3371291 - NZ_CP020931.1 Marinobacter salarius
117 543484 543735 + NZ_CP012621.1 Zobellella denitrificans
118 1862547 1862810 + NZ_CP015249.1 Dokdonella koreensis DS-123
119 414937 415200 + NC_004545.1 Buchnera aphidicola str. Bp (Baizongia pistaciae)
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP021425.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01595.22 0.76 90 2637 opposite-strand Cyclin M transmembrane N-terminal domain
2 PF03471.19 0.75 89 2637.5 opposite-strand Transporter associated domain
3 PF00571.30 0.71 84 2634 opposite-strand CBS domain
4 PF01578.22 0.77 91 1781.0 opposite-strand Cytochrome C assembly protein
5 PF00448.24 0.78 92 247 same-strand SRP54-type protein, GTPase domain
6 PF02978.21 0.78 92 247 same-strand Signal peptide binding domain
7 PF02881.21 0.78 92 247 same-strand SRP54-type protein, helical bundle domain
8 PF01782.20 1.0 118 19 same-strand RimM N-terminal domain
9 PF05239.18 0.96 113 19.0 same-strand PRC-barrel domain
10 PF01746.23 0.99 117 598.0 same-strand tRNA (Guanine-1)-methyltransferase
11 PF01245.22 1.0 118 1398 same-strand Ribosomal protein L19
++ More..