Result : Q057B2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP000263.1 |
| Organism | Buchnera aphidicola subsp. Cinara cedri (strain Cc) |
| Left | 364566 |
| Right | 364763 |
| Strand | - |
| Nucleotide Sequence | ATGAATATTATTGAAAAAAACAATATTGATAAAAATCATTTAAAAAAAAATTTATTAGATTTATTGAAAGAACAATTTAATATTCGTCTTCAATTATCTTCTGGAAAATTAAAAAAAACACATTTAGTAAAAAAAAATAAGAAAGATATTGCACGTATAAAAACAGTTTTAAATAAAAGGATTAATCATACTTTATGA |
| Sequence | MNIIEKNNIDKNHLKKNLLDLLKEQFNIRLQLSSGKLKKTHLVKKNKKDIARIKTVLNKRINHTL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 17038625 |
| Domain | |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q057B2 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3434365 | 3434556 | + | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 2 | 1880716 | 1880907 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 3 | 1713320 | 1713514 | - | NZ_LR699114.1 | Aquicella lusitana |
| 4 | 480266 | 480460 | + | NZ_LR699119.1 | Aquicella siphonis |
| 5 | 1314261 | 1314464 | - | NZ_CP071057.1 | Marinicauda algicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP024201.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03947.20 | 1.0 | 5 | 1802 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 2 | PF00181.25 | 1.0 | 5 | 1802 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00203.23 | 1.0 | 5 | 1487 | same-strand | Ribosomal protein S19 |
| 4 | PF00237.21 | 1.0 | 5 | 1143 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00189.22 | 1.0 | 5 | 426 | same-strand | Ribosomal protein S3, C-terminal domain |
| 6 | PF07650.19 | 1.0 | 5 | 426 | same-strand | KH domain |
| 7 | PF00252.20 | 1.0 | 5 | 0 | same-strand | Ribosomal protein L16p/L10e |
| 8 | PF00366.22 | 1.0 | 5 | 0 | same-strand | Ribosomal protein S17 |
| 9 | PF00238.21 | 0.8 | 4 | 349.5 | same-strand | Ribosomal protein L14p/L23e |
| 10 | PF17136.6 | 0.8 | 4 | 731.5 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 11 | PF00467.31 | 0.8 | 4 | 731.5 | same-strand | KOW motif |
| 12 | PF00673.23 | 0.8 | 4 | 1053.0 | same-strand | ribosomal L5P family C-terminus |
| 13 | PF00281.21 | 0.8 | 4 | 1053.0 | same-strand | Ribosomal protein L5 |
| 14 | PF00253.23 | 0.8 | 4 | 1637.0 | same-strand | Ribosomal protein S14p/S29e |
++ More..