Result : Q05459
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Virulence-associated protein VagC |
| NCBI Accession ID | |
| Organism | Salmonella dublin |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00877. Profile Description: Antidote-toxin recognition MazE, bacterial antitoxin. PrlF_antitoxin is a family of bacterial antitoxins that neutralizes the toxin YhaV. PrlF is labile and forms a homodimer that then binds to the YhaV toxin thereby neutralising its ribonuclease activity. Alone, it can also act as a transcription factor. The YhaV/PrlF complex binds the prlF-yhaV operon, probably regulating its expression negatively. Over-expression of PrlF leads to increased doubling time. |
| Pubmed ID | 1495391 |
| Domain | CDD:412624 |
| Functional Category | DNA-binding |
| Uniprot ID | Q05459 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 524926 | 525156 | + | NZ_CP019706.1 | Pantoea alhagi |
| 2 | 3134990 | 3135220 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 3 | 5497887 | 5498117 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 4 | 3196751 | 3196981 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 5 | 3660447 | 3660677 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 6 | 32786 | 33016 | + | NZ_CP063426.1 | Kosakonia pseudosacchari |
| 7 | 6002 | 6232 | + | NC_016846.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 8 | 13684 | 13914 | + | NZ_CP054255.1 | Klebsiella variicola |
| 9 | 77720 | 77950 | + | NZ_CP028272.1 | Mixta intestinalis |
| 10 | 123569 | 123799 | + | NZ_CP011600.1 | Phytobacter ursingii |
| 11 | 3531514 | 3531744 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 12 | 15228 | 15458 | + | NZ_CP034939.1 | Pectobacterium odoriferum |
| 13 | 33938 | 34168 | - | NC_013717.1 | Citrobacter rodentium ICC168 |
| 14 | 79797 | 80027 | + | NZ_CP050151.1 | Hafnia alvei |
| 15 | 29034 | 29264 | + | NZ_CP051549.1 | Phytobacter diazotrophicus |
| 16 | 15964 | 16194 | - | NZ_CP013942.1 | Cronobacter malonaticus LMG 23826 |
| 17 | 4030593 | 4030823 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 18 | 13141 | 13371 | + | NZ_CP023707.1 | Edwardsiella tarda |
| 19 | 68027 | 68257 | - | NZ_CP033743.1 | Citrobacter freundii |
| 20 | 244656 | 244886 | + | NZ_LN907828.1 | Erwinia gerundensis |
| 21 | 2447875 | 2448105 | - | NZ_CP053416.1 | Salmonella bongori |
| 22 | 326381 | 326611 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 23 | 262134 | 262364 | - | NZ_CP006570.1 | Sodalis praecaptivus |
| 24 | 4821566 | 4821796 | + | NZ_CP065640.1 | Serratia rubidaea |
| 25 | 4042904 | 4043131 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 26 | 3065847 | 3066065 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 27 | 828567 | 828794 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 28 | 2759100 | 2759327 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 29 | 40044 | 40271 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 30 | 1329278 | 1329505 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 31 | 2854194 | 2854421 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 32 | 4109970 | 4110197 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 33 | 4918519 | 4918749 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 34 | 3087537 | 3087764 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 35 | 73427 | 73657 | + | NZ_CP045303.1 | Azotobacter salinestris |
| 36 | 3776420 | 3776650 | + | NZ_CP041730.1 | Chitinimonas arctica |
| 37 | 356115 | 356342 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 38 | 134741 | 134974 | + | NZ_CP040022.1 | Salinivibrio kushneri |
| 39 | 1665047 | 1665280 | + | NZ_LT960612.1 | Vibrio tapetis subsp. tapetis |
| 40 | 22550 | 22783 | - | NZ_LT960612.1 | Vibrio tapetis subsp. tapetis |
| 41 | 3358491 | 3358721 | - | NZ_CP013106.1 | Halomonas huangheensis |
| 42 | 5372826 | 5373053 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 43 | 1808495 | 1808758 | + | NC_007510.1 | Burkholderia lata |
| 44 | 3090996 | 3091259 | + | NZ_CP011503.1 | Burkholderia pyrrocinia |
| 45 | 1819840 | 1820100 | + | NZ_CP045235.1 | Burkholderia cepacia |
| 46 | 1962451 | 1962714 | + | NZ_CP013414.1 | Burkholderia ubonensis |
| 47 | 1800115 | 1800378 | + | NZ_CP020737.1 | Paraburkholderia acidophila |
| 48 | 3157183 | 3157416 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 49 | 1920931 | 1921194 | + | NZ_CP013459.1 | Burkholderia stagnalis |
| 50 | 814973 | 815233 | - | NZ_CP066076.1 | Paraburkholderia ginsengisoli |
| 51 | 4393790 | 4394011 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 52 | 1852867 | 1853115 | + | NZ_CP013401.1 | Burkholderia metallica |
| 53 | 3636185 | 3636412 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 54 | 6042488 | 6042721 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 55 | 19691 | 19924 | + | NZ_CP048880.1 | Spartinivicinus ruber |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019706.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.86 | 43 | -3.0 | same-strand | PIN domain |
++ More..