Result : Q05363
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable acyl carrier protein (ACP) |
| NCBI Accession ID | L05390.1 |
| Organism | Streptomyces halstedii |
| Left | 4617 |
| Right | 4895 |
| Strand | + |
| Nucleotide Sequence | ATGACCGACATGACCGAACGCGTGGGCACCCAGGTGACCTTCGAGGAACTGTCCGCCCTGATGAAGCGCACCGCGGGCGTGCACGTGGAACCGCCTGACCTGCGGGCGCGGGCCGAGGAGGGCTTCGACGGCTTCGGCCTGGACTCCCTGGGCCTGCTGGGCATCGTGGCCGAGCTGGAGAAGAAGCACGGCGTGGGACTGCCGGAGCAGGTGGAGCGCTGCAAGACGCCCGCGGAGTTCCTCGCGCAGGTGAACGCCACCCTCAGGACGGCGGTGTGA |
| Sequence | MTDMTERVGTQVTFEELSALMKRTAGVHVEPPDLRARAEEGFDGFGLDSLGLLGIVAELEKKHGVGLPEQVERCKTPAEFLAQVNATLRTAV |
| Source of smORF | Swiss-Prot |
| Function | Involved in developmentally regulated synthesis of a compound biosynthetically related to polyketide antibiotics which is essential for spore color in Streptomyces halstedii. |
| Pubmed ID | 8344517 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q05363 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4915829 | 4916074 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 2 | 5392278 | 5392547 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 3 | 246311 | 246556 | - | NZ_CP023408.1 | Streptomyces fungicidicus |
| 4 | 696993 | 697238 | + | NZ_CP022310.1 | Streptomyces calvus |
| 5 | 998391 | 998651 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 6 | 4623852 | 4624091 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 7 | 6390324 | 6390569 | + | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 8 | 4068979 | 4069218 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 9 | 6942545 | 6942790 | + | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 10 | 3272384 | 3272650 | - | NZ_CP023689.1 | Streptomyces chartreusis |
| 11 | 10342500 | 10342739 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 12 | 1982038 | 1982271 | + | NZ_CP071139.1 | Streptomyces nojiriensis |
| 13 | 4679631 | 4679885 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 14 | 7937822 | 7938061 | - | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 15 | 2703177 | 2703416 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 16 | 8161380 | 8161646 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 17 | 2313015 | 2313254 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 18 | 1784861 | 1785130 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 19 | 725279 | 725536 | - | NZ_CP027306.1 | Streptomyces atratus |
| 20 | 297584 | 297844 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 21 | 2262517 | 2262777 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 22 | 1109270 | 1109530 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 23 | 1140840 | 1141091 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 24 | 5403073 | 5403312 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 25 | 4868672 | 4868911 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 26 | 949828 | 950085 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 27 | 7961398 | 7961655 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 28 | 7568451 | 7568690 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 29 | 531682 | 531921 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 30 | 6954688 | 6954924 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 31 | 6391502 | 6391759 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 32 | 4326771 | 4327028 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 33 | 688621 | 688860 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 34 | 7314432 | 7314686 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 35 | 936914 | 937144 | - | NZ_CP023691.1 | Streptomyces platensis |
| 36 | 2228003 | 2228260 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 37 | 811942 | 812172 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 38 | 3486761 | 3487018 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 39 | 5182386 | 5182631 | + | NZ_CP029043.1 | Streptomyces nigra |
| 40 | 7811857 | 7812114 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 41 | 6759756 | 6760013 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 42 | 1897986 | 1898210 | - | NZ_CP070326.1 | Streptomyces noursei |
| 43 | 6241220 | 6241474 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 44 | 246044 | 246280 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 45 | 707820 | 708080 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 46 | 7079354 | 7079614 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 47 | 2820353 | 2820610 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 48 | 1805036 | 1805281 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 49 | 914751 | 914996 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP023408.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04673.14 | 0.98 | 47 | 509.5 | same-strand | Polyketide synthesis cyclase |
| 2 | PF03364.22 | 0.98 | 47 | 2 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 3 | PF10604.11 | 0.98 | 47 | 2 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 4 | PF00109.28 | 0.98 | 47 | 717.5 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 5 | PF02801.24 | 0.98 | 47 | 717.5 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 6 | PF07883.13 | 0.98 | 47 | 2553.5 | same-strand | Cupin domain |
| 7 | PF04486.14 | 1.0 | 48 | 3072.0 | same-strand | SchA/CurD like domain |
| 8 | PF03992.18 | 1.0 | 48 | 3072 | same-strand | Antibiotic biosynthesis monooxygenase |
| 9 | PF01494.21 | 0.83 | 40 | 4426.0 | opposite-strand | FAD binding domain |
| 10 | PF13229.8 | 0.79 | 38 | 2019.5 | opposite-strand | Right handed beta helix region |
| 11 | PF00891.20 | 0.83 | 40 | 929.5 | opposite-strand | O-methyltransferase domain |
| 12 | PF16864.7 | 0.79 | 38 | 932.5 | opposite-strand | Dimerisation domain |
++ More..