Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0235 protein LBL_1291 |
NCBI Accession ID | CP000348.1 |
Organism | Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) |
Left | 1513855 |
Right | 1514076 |
Strand | + |
Nucleotide Sequence | ATGAAATTTACGGTTCGCGTTAAACCGAATTCAAAGAAGATTTTTTTTAGAAAAGAGGAAGACGGATCTGTGACGATCGCGGTGCGGGAGCCCGCTTTGGAAGGAAAGGCGAACGAGGCGGTGATCGAAACGATTTCACGGGAAATGAAAATTCCCAAAAGAAAAATTAGGATCGTTTCCGGTGAAAAAGGAAAGAAGAAGACGATCGAAATTGATCCTTAA |
Sequence | MKFTVRVKPNSKKIFFRKEEDGSVTIAVREPALEGKANEAVIETISREMKIPKRKIRIVSGEKGKKKTIEIDP |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
Pubmed ID | 16973745 |
Domain | CDD:412584 |
Functional Category | Others |
Uniprot ID | Q052F7 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2466947 | 2467168 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
2 | 3245957 | 3246178 | - | NZ_CP030142.1 | Leptospira mayottensis |
3 | 3907524 | 3907745 | + | NZ_CP033614.1 | Leptospira kmetyi |
4 | 515802 | 516023 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
5 | 1647395 | 1647616 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01553.23 | 0.6 | 3 | 6933 | opposite-strand | Acyltransferase |
2 | PF01734.24 | 0.6 | 3 | 5938 | opposite-strand | Patatin-like phospholipase |
3 | PF19890.1 | 0.6 | 3 | 5938 | opposite-strand | Domain of unknown function (DUF6363) |
4 | PF12680.9 | 0.6 | 3 | 5259 | same-strand | SnoaL-like domain |
5 | PF12802.9 | 0.8 | 4 | 5161.0 | opposite-strand | MarR family |
6 | PF01047.24 | 0.8 | 4 | 5161.0 | opposite-strand | MarR family |
7 | PF13463.8 | 0.8 | 4 | 5161.0 | opposite-strand | Winged helix DNA-binding domain |
8 | PF03023.16 | 1.0 | 5 | 10 | same-strand | Lipid II flippase MurJ |
9 | PF14667.8 | 1.0 | 5 | 10 | same-strand | Polysaccharide biosynthesis C-terminal domain |
10 | PF01740.23 | 1.0 | 5 | 1609 | same-strand | STAS domain |
11 | PF13274.8 | 1.0 | 5 | 4417 | opposite-strand | Protein of unknown function (DUF4065) |
12 | PF13466.8 | 0.6 | 3 | 1610 | same-strand | STAS domain |