Result : Q04W31
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | CP000350.1 |
| Organism | Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) |
| Left | 178828 |
| Right | 179082 |
| Strand | + |
| Nucleotide Sequence | ATGAACCAACTCGTAATCCAACTGATTCAACTTTACAAAAAGATAATTTCTCCTTTATTGCCTCCCGCATGTCGTTTTACGCCTACTTGCTCTGAATACACCATTCAGGCGTTTCGAGAGTGCGGATTTTTCCAAGCGATTCAACTCAGTGCTTGGAGAATTTTGAGATGTAATCCTCTTTCTCAGGGGTTTGAAGATCCCTTACCACCAAACACTAAAAGGACGAACCTGACTCATGGAAGACAGACAAAGTAG |
| Sequence | MNQLVIQLIQLYKKIISPLLPPACRFTPTCSEYTIQAFRECGFFQAIQLSAWRILRCNPLSQGFEDPLPPNTKRTNLTHGRQTK |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 16973745 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q04W31 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 76
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 167849 | 168103 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 2 | 999647 | 999877 | - | NZ_CP030142.1 | Leptospira mayottensis |
| 3 | 162657 | 162887 | + | NZ_CP040840.1 | Leptospira weilii |
| 4 | 2486396 | 2486641 | + | NZ_CP033614.1 | Leptospira kmetyi |
| 5 | 2474944 | 2475168 | + | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 6 | 171432 | 171662 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 7 | 3292081 | 3292323 | - | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 8 | 1022695 | 1022934 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 9 | 2288026 | 2288268 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 10 | 2794115 | 2794366 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 11 | 2361963 | 2362223 | - | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 12 | 4017 | 4268 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 13 | 284287 | 284529 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 14 | 876224 | 876454 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 15 | 1962511 | 1962750 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 16 | 1135974 | 1136231 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 17 | 1321866 | 1322075 | + | NC_018178.1 | Melioribacter roseus P3M-2 |
| 18 | 4164 | 4421 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 19 | 1618902 | 1619147 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 20 | 3813922 | 3814179 | - | NZ_CP046268.1 | Vibrio spartinae |
| 21 | 1348763 | 1349008 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 22 | 4127 | 4384 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 23 | 1271671 | 1271913 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 24 | 1325138 | 1325383 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 25 | 1339337 | 1339582 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 26 | 2511479 | 2511757 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 27 | 1824043 | 1824270 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 28 | 2294698 | 2294937 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 29 | 3698485 | 3698712 | + | NZ_CP040449.1 | Aeromonas simiae |
| 30 | 3424447 | 3424662 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 31 | 3090481 | 3090690 | - | NZ_CP014204.2 | Clostridium baratii |
| 32 | 808716 | 808955 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 33 | 801881 | 802120 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 34 | 2897914 | 2898171 | - | NZ_CP033078.1 | Vibrio zhugei |
| 35 | 147053 | 147310 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 36 | 3622909 | 3623187 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 37 | 81340 | 81555 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 38 | 4206 | 4463 | - | NZ_AP014635.1 | Vibrio tritonius |
| 39 | 2727954 | 2728211 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 40 | 495113 | 495370 | - | NZ_CP040990.1 | Vibrio furnissii |
| 41 | 1843330 | 1843587 | - | NZ_CP019959.1 | Vibrio owensii |
| 42 | 23782 | 24030 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 43 | 1577131 | 1577370 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 44 | 1209461 | 1209703 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 45 | 3974675 | 3974884 | - | NZ_LS483470.1 | Leminorella richardii |
| 46 | 2396674 | 2396883 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 47 | 4564821 | 4565078 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 48 | 1719078 | 1719320 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 49 | 2688598 | 2688807 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 50 | 2104048 | 2104257 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 51 | 2343673 | 2343882 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 52 | 2783933 | 2784142 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 53 | 4170837 | 4171064 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 54 | 50062 | 50274 | + | NZ_CP009761.1 | Parvimonas micra |
| 55 | 5265069 | 5265314 | - | NZ_CP041247.1 | Raoultella electrica |
| 56 | 1772944 | 1773177 | + | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 57 | 31192 | 31407 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 58 | 4157224 | 4157469 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 59 | 1923263 | 1923523 | + | NZ_CP023863.1 | Prevotella jejuni |
| 60 | 244693 | 244908 | + | NZ_LT632322.1 | Murdochiella vaginalis |
| 61 | 329691 | 329948 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 62 | 3122243 | 3122452 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 63 | 3573994 | 3574227 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 64 | 1155733 | 1155966 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 65 | 1021940 | 1022176 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 66 | 1803174 | 1803431 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 67 | 640366 | 640605 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 68 | 90472 | 90693 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 69 | 1281359 | 1281568 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 70 | 2440216 | 2440455 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 71 | 3129682 | 3129891 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 72 | 1613347 | 1613559 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 73 | 2130928 | 2131161 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 74 | 1399590 | 1399820 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 75 | 1709763 | 1710023 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 76 | 1005380 | 1005619 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014509.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.86 | 65 | 3 | same-strand | 60Kd inner membrane protein |
| 2 | PF00825.20 | 0.61 | 46 | -3.0 | same-strand | Ribonuclease P |
++ More..