Result : Q04U37
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP000350.1 |
| Organism | Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) |
| Left | 1123888 |
| Right | 1124088 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTTCCCAAAAGACGAAAATCGAAATCAAAAGTTAGAACAAAACGGGCGCATCATGCCATCGGAAAGCCGAATTTGGTTCCTTGTCCTAATTGTAATGTTTACAGGTTACCTCATAGAATTTGTCCTACCTGCGGGTTTTATAAAACCGGAATCGTTTTAGAGCCGAAAGTCAAGAAGCCAAAAGAAGAAAATTAA |
| Sequence | MAVPKRRKSKSKVRTKRAHHAIGKPNLVPCPNCNVYRLPHRICPTCGFYKTGIVLEPKVKKPKEEN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 16973745 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q04U37 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2863756 | 2863956 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 2 | 3479123 | 3479323 | + | NZ_CP033614.1 | Leptospira kmetyi |
| 3 | 972177 | 972377 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 4 | 3587321 | 3587521 | - | NZ_CP030142.1 | Leptospira mayottensis |
| 5 | 1874669 | 1874869 | + | NZ_CP040840.1 | Leptospira weilii |
| 6 | 1176301 | 1176501 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 7 | 4156630 | 4156833 | - | NC_018020.1 | Turneriella parva DSM 21527 |
| 8 | 1457822 | 1458007 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 9 | 2641561 | 2641740 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 10 | 1704635 | 1704817 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 11 | 672019 | 672201 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 12 | 1829739 | 1829921 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 13 | 1959631 | 1959828 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 14 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 15 | 7257131 | 7257313 | - | NZ_CP061800.1 | Desulfonema magnum |
| 16 | 1586935 | 1587129 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 17 | 1009182 | 1009361 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 18 | 1619826 | 1620005 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 19 | 137691 | 137873 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 20 | 1633326 | 1633517 | - | NZ_CP014159.1 | Aerococcus christensenii |
| 21 | 1518673 | 1518855 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 22 | 569602 | 569784 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 23 | 2269818 | 2270000 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 24 | 1471418 | 1471594 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 25 | 1968030 | 1968206 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 26 | 1843396 | 1843578 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 27 | 1322379 | 1322555 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 28 | 3264320 | 3264514 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 29 | 245826 | 246008 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 30 | 1462250 | 1462426 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 31 | 2092662 | 2092847 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 32 | 2049283 | 2049465 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 33 | 2534925 | 2535104 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 34 | 3071019 | 3071201 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 35 | 163866 | 164048 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 36 | 13862 | 14044 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 37 | 4077467 | 4077640 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 38 | 523933 | 524115 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 39 | 1560680 | 1560862 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 40 | 2190921 | 2191100 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 41 | 1367078 | 1367257 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 42 | 752159 | 752338 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 43 | 806868 | 807050 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 44 | 787795 | 787977 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 45 | 789214 | 789396 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 46 | 540002 | 540184 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 47 | 3843228 | 3843422 | - | NZ_CP042912.1 | Mariniblastus fucicola |
| 48 | 1402114 | 1402299 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 49 | 4203459 | 4203635 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 50 | 1979644 | 1979838 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 51 | 723354 | 723533 | + | NZ_CP009302.1 | Berryella intestinalis |
| 52 | 2132555 | 2132749 | - | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
++ More..