Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | CP000350.1 |
Organism | Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) |
Left | 1514653 |
Right | 1514943 |
Strand | - |
Nucleotide Sequence | ATGGCGGAAGCAAGATCAAAAATTTCATTTGAAGATGCTCTGGTTGAGCTGGAACAAATCGCGGAAAAATTGGAGCGCCAAGACTTTAGTCTGGAAGAGTCTCTCAAGGCGTATGAAAGGGGGATGGAACTCAAAAAAATCTGCCGGGGAATTTTGGATTCTGCGGAAGGAAAGATAGAAGCCCTTACCAAAGACGAGTCGCAAAAGACAAACAAAACCGGTTTTCGGACAGAATCCAAATCGACATCCCAAACTTCCTCCGATTCCGTTTTAGAAGAAGATCTCTTTTAA |
Sequence | MAEARSKISFEDALVELEQIAEKLERQDFSLEESLKAYERGMELKKICRGILDSAEGKIEALTKDESQKTNKTGFRTESKSTSQTSSDSVLEEDLF |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 16973745 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q04TB2 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2332940 | 2333230 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
2 | 3081811 | 3082101 | + | NZ_CP030142.1 | Leptospira mayottensis |
3 | 2428795 | 2429079 | - | NZ_CP040840.1 | Leptospira weilii |
4 | 4239867 | 4240154 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
5 | 2134094 | 2134390 | - | NZ_CP015217.1 | Leptospira tipperaryensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09335.13 | 1.0 | 5 | 3021 | opposite-strand | SNARE associated Golgi protein |
2 | PF01594.18 | 1.0 | 5 | 1278 | same-strand | AI-2E family transporter |
3 | PF02601.17 | 1.0 | 5 | 3 | same-strand | Exonuclease VII, large subunit |
4 | PF13742.8 | 1.0 | 5 | 3 | same-strand | OB-fold nucleic acid binding domain |
5 | PF01336.27 | 1.0 | 5 | 3 | same-strand | OB-fold nucleic acid binding domain |
6 | PF02867.17 | 1.0 | 5 | 1182 | same-strand | Ribonucleotide reductase, barrel domain |
7 | PF08471.12 | 1.0 | 5 | 1182 | same-strand | Class II vitamin B12-dependent ribonucleotide reductase |
8 | PF14450.8 | 0.6 | 3 | 7204 | opposite-strand | Cell division protein FtsA |