Result : Q04TB2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000350.1 |
| Organism | Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) |
| Left | 1514653 |
| Right | 1514943 |
| Strand | - |
| Nucleotide Sequence | ATGGCGGAAGCAAGATCAAAAATTTCATTTGAAGATGCTCTGGTTGAGCTGGAACAAATCGCGGAAAAATTGGAGCGCCAAGACTTTAGTCTGGAAGAGTCTCTCAAGGCGTATGAAAGGGGGATGGAACTCAAAAAAATCTGCCGGGGAATTTTGGATTCTGCGGAAGGAAAGATAGAAGCCCTTACCAAAGACGAGTCGCAAAAGACAAACAAAACCGGTTTTCGGACAGAATCCAAATCGACATCCCAAACTTCCTCCGATTCCGTTTTAGAAGAAGATCTCTTTTAA |
| Sequence | MAEARSKISFEDALVELEQIAEKLERQDFSLEESLKAYERGMELKKICRGILDSAEGKIEALTKDESQKTNKTGFRTESKSTSQTSSDSVLEEDLF |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 16973745 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q04TB2 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2332940 | 2333230 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 2 | 3081811 | 3082101 | + | NZ_CP030142.1 | Leptospira mayottensis |
| 3 | 2428795 | 2429079 | - | NZ_CP040840.1 | Leptospira weilii |
| 4 | 4239867 | 4240154 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 5 | 2134094 | 2134390 | - | NZ_CP015217.1 | Leptospira tipperaryensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP026671.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09335.13 | 1.0 | 5 | 3021 | opposite-strand | SNARE associated Golgi protein |
| 2 | PF01594.18 | 1.0 | 5 | 1278 | same-strand | AI-2E family transporter |
| 3 | PF02601.17 | 1.0 | 5 | 3 | same-strand | Exonuclease VII, large subunit |
| 4 | PF13742.8 | 1.0 | 5 | 3 | same-strand | OB-fold nucleic acid binding domain |
| 5 | PF01336.27 | 1.0 | 5 | 3 | same-strand | OB-fold nucleic acid binding domain |
| 6 | PF02867.17 | 1.0 | 5 | 1182 | same-strand | Ribonucleotide reductase, barrel domain |
| 7 | PF08471.12 | 1.0 | 5 | 1182 | same-strand | Class II vitamin B12-dependent ribonucleotide reductase |
| 8 | PF14450.8 | 0.6 | 3 | 7204 | opposite-strand | Cell division protein FtsA |
++ More..