Result : Q04T16
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S21 |
| NCBI Accession ID | CP000350.1 |
| Organism | Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) |
| Left | 1631605 |
| Right | 1631814 |
| Strand | + |
| Nucleotide Sequence | ATGGTAGGAATCATTGTAAAAGACGGAGAATCGATCGAATCTGCTTTGAAACGTTTCAAGCGTGACTGCGCGAATGCAGGTATTATGAGCGAAATTAAACGAAGAGAATACTTTGAAAAACCGAGTATCAAAAAGAAAAAAGCGATCGAGTCCGCAAAAAGAAAAGCAGAAAAGAAAAAACGTCTTTTCTCAAAAAAAGATAAGGCTTAA |
| Sequence | MVGIIVKDGESIESALKRFKRDCANAGIMSEIKRREYFEKPSIKKKKAIESAKRKAEKKKRLFSKKDKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | 16973745 |
| Domain | CDD:412427 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q04T16 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2036587 | 2036796 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 2 | 2152218 | 2152427 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 3 | 2948205 | 2948414 | + | NZ_CP030142.1 | Leptospira mayottensis |
| 4 | 362465 | 362674 | + | NZ_CP033614.1 | Leptospira kmetyi |
| 5 | 2578313 | 2578522 | - | NZ_CP040840.1 | Leptospira weilii |
| 6 | 81260 | 81469 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 7 | 764605 | 764784 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 8 | 1708402 | 1708584 | - | NC_008593.1 | Clostridium novyi NT |
| 9 | 2062353 | 2062550 | - | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 10 | 1277705 | 1277914 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 11 | 1149329 | 1149505 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 12 | 453887 | 454069 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 13 | 937600 | 937779 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 14 | 584610 | 584792 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 15 | 1927685 | 1927864 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 16 | 1342890 | 1343069 | + | NZ_CP019870.1 | Clostridioides difficile |
| 17 | 683317 | 683496 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 18 | 341324 | 341503 | + | NZ_CP009761.1 | Parvimonas micra |
| 19 | 3399106 | 3399303 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 20 | 911498 | 911677 | + | NZ_LT632322.1 | Murdochiella vaginalis |
| 21 | 3341104 | 3341301 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 22 | 1375812 | 1375994 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 23 | 952722 | 952928 | - | NZ_CP009498.1 | Endomicrobium proavitum |
| 24 | 494512 | 494709 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 25 | 396014 | 396214 | + | NC_020813.1 | Bdellovibrio exovorus JSS |
| 26 | 2290496 | 2290711 | + | NZ_CP023559.1 | Salinicola tamaricis |
| 27 | 225379 | 225573 | + | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 28 | 62223 | 62438 | - | NC_004545.1 | Buchnera aphidicola str. Bp (Baizongia pistaciae) |
| 29 | 2858496 | 2858672 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 30 | 2190917 | 2191090 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015217.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09424.12 | 0.6 | 18 | 31.5 | same-strand | Yqey-like protein |
++ More..