Result : A6V1W3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0270 protein PSPA7_1664 |
| NCBI Accession ID | CP000744.1 |
| Organism | Pseudomonas aeruginosa (strain PA7) |
| Left | 1704461 |
| Right | 1704691 |
| Strand | - |
| Nucleotide Sequence | ATGCTGATCCCCCACGACCTGCTCGAAGCCGACACCCTGAACAACCTGCTGGAGGACTTCGTCACCCGCGAAGGCACCGACAACGGCGACGAGACCCCGCTGGACGTGCGCGTGGAACGCGCCCGCCATGCCTTGCGGCGGGGCGAGGCGGTGATCCTGTTCGACCCGGAGAGCCAGCAGTGCCAGTTGATGTTGCGCAGCGAGGTGCCTGCGGAGCTGTTGCGCGACTGA |
| Sequence | MLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01180. Profile Description: Uncharacterized protein family (UPF0270). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412782 |
| Functional Category | Others |
| Uniprot ID | A6V1W3 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 56
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3873606 | 3873836 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 2335547 | 2335777 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 3 | 4267940 | 4268170 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 4 | 5066189 | 5066419 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 5 | 4700230 | 4700460 | + | NZ_AP014862.1 | Pseudomonas furukawaii |
| 6 | 2649893 | 2650135 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 7 | 4250354 | 4250581 | - | NZ_CP045302.1 | Azotobacter salinestris |
| 8 | 1936531 | 1936767 | - | NZ_LR215729.2 | Pseudomonas marincola |
| 9 | 4996939 | 4997166 | + | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 10 | 4436447 | 4436674 | + | NZ_CP068034.2 | Pseudomonas syringae |
| 11 | 1307315 | 1307542 | - | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 12 | 4417635 | 4417862 | + | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 13 | 1785076 | 1785303 | - | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 14 | 3094536 | 3094763 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 15 | 4936886 | 4937113 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 16 | 2071797 | 2072048 | - | NZ_CP060009.1 | Pseudomonas sediminis |
| 17 | 1288411 | 1288641 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 18 | 1145133 | 1145360 | - | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 19 | 1504814 | 1505041 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 20 | 1824369 | 1824596 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 21 | 4159337 | 4159564 | + | NZ_CP023272.1 | Pseudomonas lurida |
| 22 | 212212 | 212439 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 23 | 5397144 | 5397371 | - | NZ_CP014262.1 | Pseudomonas corrugata |
| 24 | 418046 | 418297 | + | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 25 | 1793527 | 1793754 | - | NZ_CP035088.1 | Pseudomonas viciae |
| 26 | 2358210 | 2358437 | + | NZ_CP048810.1 | Pseudomonas bijieensis |
| 27 | 1826343 | 1826570 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 28 | 3575347 | 3575574 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 29 | 5274682 | 5274909 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 30 | 1456311 | 1456538 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 31 | 4528925 | 4529152 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 32 | 4151257 | 4151484 | + | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 33 | 3990687 | 3990914 | + | NZ_CP027723.1 | Pseudomonas orientalis |
| 34 | 4253354 | 4253581 | + | NZ_CP010896.1 | Pseudomonas simiae |
| 35 | 4438630 | 4438857 | + | NZ_CP027756.1 | Pseudomonas synxantha |
| 36 | 4757698 | 4757925 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 37 | 4444990 | 4445217 | + | NZ_CP012400.2 | Pseudomonas yamanorum |
| 38 | 4233061 | 4233288 | + | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 39 | 3583974 | 3584225 | + | NZ_CP068551.1 | Pseudomonas khazarica |
| 40 | 1534075 | 1534302 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 41 | 3381264 | 3381491 | + | NZ_CP009365.1 | Pseudomonas soli |
| 42 | 4785938 | 4786165 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 43 | 4862952 | 4863179 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 44 | 4580970 | 4581197 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 45 | 1850375 | 1850626 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 46 | 2015464 | 2015691 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 47 | 2774069 | 2774296 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 48 | 1503065 | 1503292 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 49 | 4101075 | 4101302 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 50 | 1477295 | 1477522 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 51 | 2100485 | 2100712 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 52 | 3047704 | 3047931 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 53 | 4283438 | 4283665 | + | NZ_CP071706.1 | Pseudomonas donghuensis |
| 54 | 1572805 | 1573032 | - | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 55 | 1052348 | 1052602 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 56 | 2976799 | 2977032 | - | NZ_CP029822.1 | Entomomonas moraniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP068034.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00733.23 | 0.88 | 49 | 3164 | same-strand | Asparagine synthase |
| 2 | PF13537.8 | 0.88 | 49 | 3164 | same-strand | Glutamine amidotransferase domain |
| 3 | PF13522.8 | 0.88 | 49 | 3164 | same-strand | Glutamine amidotransferase domain |
| 4 | PF13508.9 | 0.88 | 49 | 1414 | same-strand | Acetyltransferase (GNAT) domain |
| 5 | PF05343.16 | 0.88 | 49 | 102 | same-strand | M42 glutamyl aminopeptidase |
| 6 | PF11752.10 | 0.73 | 41 | 1778 | same-strand | Protein of unknown function (DUF3309) |
| 7 | PF00106.27 | 0.68 | 38 | 726.0 | opposite-strand | short chain dehydrogenase |
| 8 | PF13561.8 | 0.68 | 38 | 726.0 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 9 | PF08659.12 | 0.68 | 38 | 726.0 | opposite-strand | KR domain |
| 10 | PF02599.18 | 0.64 | 36 | 6.0 | opposite-strand | Global regulator protein family |
++ More..