Result : Q04SA4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000350.1 |
| Organism | Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) |
| Left | 1957065 |
| Right | 1957355 |
| Strand | - |
| Nucleotide Sequence | ATGAACTTGAACGAAGATTCTTTGCGAAAAATCGCCGAACTCTCGCGTTTGAACATCCGTCCTAAGGAAAAGGAAGCAACTCTTCGGGACTTTAACAAGATTTTGGAATACGTGGATCAAGTAAAAGGTCTGGACGTAAGTTCGATCAGAGACGACGAGATTTACTTTCGGCATGAGAATTCGATTCGTCCGGATCTTGTGGGTCAACATCTTTCTCGGGAAGAAATCGAAAAGTTTGCGCCTTCCTTTCAAAACGGATATTTCGTCGTCCCTAAGGTAATCGAAACATGA |
| Sequence | MNLNEDSLRKIAELSRLNIRPKEKEATLRDFNKILEYVDQVKGLDVSSIRDDEIYFRHENSIRPDLVGQHLSREEIEKFAPSFQNGYFVVPKVIET |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 16973745 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q04SA4 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1805100 | 1805390 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 2 | 2551409 | 2551699 | + | NZ_CP030142.1 | Leptospira mayottensis |
| 3 | 2017447 | 2017737 | + | NZ_CP040840.1 | Leptospira weilii |
| 4 | 2357159 | 2357449 | - | NZ_CP015217.1 | Leptospira tipperaryensis |
| 5 | 665348 | 665638 | - | NZ_CP033614.1 | Leptospira kmetyi |
| 6 | 4091952 | 4092242 | + | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP026671.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02559.18 | 1.0 | 6 | 6068.0 | same-strand | CarD-like/TRCF domain |
| 2 | PF17757.3 | 1.0 | 6 | 6068.0 | same-strand | UvrB interaction domain |
| 3 | PF03461.17 | 1.0 | 6 | 6068.0 | same-strand | TRCF domain |
| 4 | PF00271.33 | 1.0 | 6 | 6068.0 | same-strand | Helicase conserved C-terminal domain |
| 5 | PF00270.31 | 1.0 | 6 | 6068.0 | same-strand | DEAD/DEAH box helicase |
| 6 | PF04851.17 | 1.0 | 6 | 6068.0 | same-strand | Type III restriction enzyme, res subunit |
| 7 | PF02673.20 | 1.0 | 6 | 4459.0 | same-strand | Bacitracin resistance protein BacA |
| 8 | PF02397.18 | 1.0 | 6 | 28.0 | same-strand | Bacterial sugar transferase |
| 9 | PF13727.8 | 1.0 | 6 | 28.0 | same-strand | CoA-binding domain |
| 10 | PF01425.23 | 1.0 | 6 | -3.0 | same-strand | Amidase |
| 11 | PF00977.23 | 1.0 | 6 | 1457.0 | same-strand | Histidine biosynthesis protein |
| 12 | PF00588.21 | 0.67 | 4 | 5834.0 | opposite-strand | SpoU rRNA Methylase family |
++ More..