ProsmORF-pred
Result : Q04JL4
Protein Information
Information Type Description
Protein name UPF0213 protein SPD_1364
NCBI Accession ID CP000410.2
Organism Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Left 1378954
Right 1379253
Strand -
Nucleotide Sequence ATGGATCATAAGGCTTATATGTACGTTCTGGAGTGTCGTGATGGATCCTACTATATAGGCTATACGACTGATATGAGAAGACGCCTCGCTATCCACAATAGTGGGAAGGGAGCCAAATATACACGAGCACGCTTGCCAGTCAAACTTATCTATGCTCAAGGTTTTGCCAGTAAGGAAGAAGCCATGTCGGCTGAAGCTCTTTTCAAGCGTAAGAAGAGGCCACAGAAGGAAGAATTTTTATCTGAAAATCAAGATAGAAATTTACTCAGTTATTTTGAAGAATCGTGGGGAGTCCTTTGA
Sequence MDHKAYMYVLECRDGSYYIGYTTDMRRRLAIHNSGKGAKYTRARLPVKLIYAQGFASKEEAMSAEALFKRKKRPQKEEFLSENQDRNLLSYFEESWGVL
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues.
Pubmed ID 17041037
Domain CDD:417687
Functional Category Others
Uniprot ID Q04JL4
ORF Length (Amino Acid) 99
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 95
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1164331 1164618 - NZ_CP032621.1 Streptococcus gwangjuense
2 1441051 1441338 - NC_015875.1 Streptococcus pseudopneumoniae IS7493
3 1323457 1323741 - NZ_LR134336.1 Streptococcus oralis ATCC 35037
4 1530344 1530586 + NZ_LR134275.1 Streptococcus vestibularis
5 1505032 1505301 + NC_017581.1 Streptococcus thermophilus JIM 8232
6 1495051 1495320 + NC_012924.1 Streptococcus suis SC84
7 1305553 1305816 + NZ_LS483436.1 Streptococcus intermedius
8 2124578 2124829 - NZ_CP014835.1 Streptococcus halotolerans
9 1313837 1314094 + NZ_CP034543.1 Streptococcus periodonticum
10 1329079 1329336 + NZ_CP012805.1 Streptococcus anginosus
11 1456137 1456397 + NZ_CP025536.1 Streptococcus pluranimalium
12 783475 783720 - NZ_LR134512.1 Streptococcus agalactiae
13 1465817 1466089 - NZ_CP054015.1 Streptococcus gallolyticus
14 1520929 1521180 + NZ_AP014612.1 Streptococcus troglodytae
15 1037396 1037647 + NZ_CP013237.1 Streptococcus mutans
16 1649906 1650172 + NZ_LR594049.1 Streptococcus gordonii
17 612538 612810 - NZ_AP018400.1 Streptococcus ruminantium
18 690846 691106 + NZ_LR134341.1 Streptococcus pseudoporcinus
19 154500 154742 + NZ_CP043405.1 Streptococcus ratti
20 631980 632225 - NZ_CP029491.1 Streptococcus sobrinus
21 565826 566086 - NZ_LR594050.1 Streptococcus porcinus
22 583646 583891 - NZ_CP039457.1 Streptococcus pasteurianus
23 673391 673654 - NZ_LS483383.1 Streptococcus cristatus ATCC 51100
24 532334 532609 - NZ_LS483403.1 Streptococcus lutetiensis
25 1107043 1107294 + NZ_CP010450.1 Streptococcus pyogenes
26 1449089 1449340 + NZ_LR594046.1 Streptococcus dysgalactiae
27 1937172 1937453 + NZ_CP032620.1 Streptococcus koreensis
28 1707 1979 + NZ_CP016953.1 Streptococcus himalayensis
29 1273971 1274249 - NZ_LR134293.1 Streptococcus canis
30 547447 547701 - NZ_LS483343.1 Streptococcus ferus
31 118982 119269 + NZ_CP015196.1 Streptococcus marmotae
32 1829142 1829387 + NZ_CP022680.1 Streptococcus respiraculi
33 1387170 1387430 + NZ_CP065061.1 Streptococcus equi subsp. zooepidemicus
34 1420593 1420841 + NZ_CP014699.1 Streptococcus pantholopis
35 749828 750076 - NZ_CP031733.1 Streptococcus chenjunshii
36 804547 804837 + NZ_LR134484.1 Gemella haemolysans
37 38154 38438 + NZ_CP023704.1 Caldibacillus thermoamylovorans
38 43842 44117 + NZ_CP012024.1 Bacillus smithii
39 154785 155072 + NZ_CP053989.1 Niallia circulans
40 65351 65620 + NZ_CP016543.2 Planococcus donghaensis
41 186321 186575 - NZ_CP017560.1 Sporosarcina ureilytica
42 2659187 2659474 + NZ_CP018061.1 Enterococcus mundtii
43 4641188 4641466 - NZ_CP014616.1 Sporosarcina psychrophila
44 44881 45150 + NZ_CP016537.2 Planococcus halocryophilus
45 39627 39896 + NZ_CP016540.2 Planococcus versutus
46 43347 43646 + NZ_CP051464.1 Bacillus mojavensis
47 1965777 1966076 - NZ_CP029364.1 Bacillus halotolerans
48 46652 46939 + NZ_CP024035.1 Priestia aryabhattai
49 1502668 1502967 - NZ_CP043404.1 Bacillus safensis
50 1989596 1989838 - NZ_CP018906.1 Lentilactobacillus curieae
51 1716667 1716936 - NZ_CP013661.2 Planococcus kocurii
52 1097392 1097673 - NZ_CP023011.2 Enterococcus hirae
53 43364 43633 + NZ_CP034943.1 Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
54 45936 46205 + NZ_CP019401.1 Planococcus faecalis
55 65874 66137 + NZ_CP006837.1 Lysinibacillus varians
56 4655656 4655919 - NZ_CP019980.1 Lysinibacillus sphaericus
57 2483441 2483701 + NZ_CP030926.1 Peribacillus butanolivorans
58 2380392 2380676 + NZ_CP065211.1 Enterococcus lactis
59 2530063 2530323 - NZ_CP017704.1 Peribacillus simplex NBRC 15720 = DSM 1321
60 36420 36707 + NZ_LS483476.1 Lederbergia lentus
61 46365 46634 + NC_013791.2 Alkalihalobacillus pseudofirmus OF4
62 39923 40183 + NZ_CP024109.1 Bacillus cytotoxicus
63 226404 226646 + NC_014297.1 Halalkalicoccus jeotgali B3
64 109847 110125 + NZ_LR134483.1 Listeria grayi
65 22561 22809 + NZ_CP011150.1 Bacillus altitudinis
66 1585718 1585966 - NZ_CP017786.1 Bacillus xiamenensis
67 2177925 2178173 + NC_020995.1 Enterococcus casseliflavus EC20
68 39321 39581 + NZ_CP064875.1 Bacillus toyonensis
69 2338392 2338640 + NZ_CP068061.1 Mammaliicoccus vitulinus
70 46207 46476 + NZ_CP016534.2 Planococcus antarcticus DSM 14505
71 682804 683052 + NZ_CP029487.1 Eubacterium maltosivorans
72 561931 562230 + NZ_CP031835.1 Lactobacillus amylolyticus
73 2313960 2314244 + NC_020207.1 Enterococcus faecium ATCC 8459 = NRRL B-2354
74 39608 39871 + NC_011725.1 Bacillus cereus B4264
75 64714 64998 + NC_002570.2 Alkalihalobacillus halodurans C-125
76 2431700 2431942 + NZ_LN831302.1 Halobacterium hubeiense
77 1692407 1692661 - NZ_CP065729.1 Macrococcus caseolyticus
78 4640563 4640844 + NZ_CP018866.1 Sutcliffiella cohnii
79 850302 850577 - NZ_CP026116.1 Latilactobacillus curvatus JCM 1096 = DSM 20019
80 903440 903754 + NZ_CP059829.1 Lactobacillus ultunensis
81 121048 121323 - NZ_CP046037.1 Latilactobacillus sakei
82 1032042 1032356 - NZ_CP015444.1 Lactobacillus helveticus
83 887664 887936 - NZ_CP017326.1 Weissella soli
84 1087073 1087345 - NZ_CP061835.1 Weissella viridescens
85 76035 76298 - NZ_CP021874.1 Enterococcus wangshanyuanii
86 91930 92232 - NZ_CP018888.1 Amylolactobacillus amylophilus DSM 20533 = JCM 1125
87 1753198 1753452 - NZ_CP025066.1 Halalkaliarchaeum desulfuricum
88 404944 405195 + NC_011899.1 Halothermothrix orenii H 168
89 1213153 1213443 - NZ_AP014680.1 Paucilactobacillus hokkaidonensis JCM 18461
90 756343 756603 + NZ_CP045605.1 Limosilactobacillus reuteri
91 154851 155144 + NC_021280.1 Spiroplasma chrysopicola DF-1
92 1965278 1965574 + NC_022369.1 Lactococcus lactis subsp. cremoris KW2
93 3866307 3866561 - NC_013743.1 Haloterrigena turkmenica DSM 5511
94 2940003 2940251 - NZ_CP034940.1 Halorubrum ezzemoulense
95 1304359 1304640 + NZ_CP049889.1 Jeotgalibaca porci
++ More..