Result : Q04GL9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP000411.1 |
| Organism | Oenococcus oeni (strain ATCC BAA-331 / PSU-1) |
| Left | 431813 |
| Right | 432013 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAAGATGCTATTACTGGCGCGCGTACTCGTTTTGGTAATCAACGTTCACACGCTTTGAATGCCAATCGTCGTTCGTGGAAGCCGAATTTGCAAAAAGTGACCGTTAAAATCAATGGCGACGCTGCCAAAACCGTTTATCTGACTGCTCGTACTTTACGTGCAGGCTTGAAGAACGGTTCGATCGAACGAGTATAA |
| Sequence | MAKDAITGARTRFGNQRSHALNANRRSWKPNLQKVTVKINGDAAKTVYLTARTLRAGLKNGSIERV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17030793 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q04GL9 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 186
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 396579 | 396779 | + | NZ_CP014324.1 | Oenococcus oeni |
| 2 | 981218 | 981418 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 3 | 1174115 | 1174315 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 4 | 1554015 | 1554215 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 5 | 202546 | 202746 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 6 | 1446143 | 1446343 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 7 | 1488628 | 1488828 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 8 | 1323903 | 1324103 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 9 | 456212 | 456412 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 10 | 1192407 | 1192607 | - | NZ_CP017326.1 | Weissella soli |
| 11 | 726078 | 726278 | + | NZ_CP027563.1 | Weissella confusa |
| 12 | 585147 | 585347 | + | NZ_CP061835.1 | Weissella viridescens |
| 13 | 2575970 | 2576170 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 14 | 374626 | 374826 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 15 | 1452911 | 1453111 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 16 | 1025886 | 1026071 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 17 | 880840 | 881025 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 18 | 1087410 | 1087595 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 19 | 1148792 | 1148977 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 20 | 1257954 | 1258139 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 21 | 1038123 | 1038308 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 22 | 655272 | 655457 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 23 | 1104528 | 1104713 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 24 | 1757692 | 1757877 | + | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 25 | 2356178 | 2356363 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 26 | 2125798 | 2125983 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 27 | 2112492 | 2112677 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 28 | 1995584 | 1995769 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 29 | 2944700 | 2944885 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 30 | 1823264 | 1823449 | - | NZ_CP018906.1 | Lentilactobacillus curieae |
| 31 | 607736 | 607921 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 32 | 1257182 | 1257367 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 33 | 224916 | 225101 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 34 | 1492141 | 1492326 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 35 | 1050120 | 1050305 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 36 | 720166 | 720351 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 37 | 1083112 | 1083297 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 38 | 414674 | 414859 | - | NZ_CP031513.1 | Bombilactobacillus bombi |
| 39 | 2899569 | 2899754 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 40 | 841666 | 841851 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 41 | 1279912 | 1280097 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 42 | 881882 | 882067 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 43 | 1151421 | 1151606 | + | NZ_CP024610.1 | Lactobacillus terrae |
| 44 | 1202016 | 1202201 | + | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 45 | 865557 | 865742 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
| 46 | 1367539 | 1367724 | + | NZ_CP049366.1 | Companilactobacillus pabuli |
| 47 | 1741537 | 1741722 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 48 | 1106351 | 1106536 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 49 | 1236373 | 1236558 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 50 | 1699919 | 1700104 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 51 | 1082906 | 1083091 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 52 | 666355 | 666540 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 53 | 1520615 | 1520800 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 54 | 1222923 | 1223108 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 55 | 1892150 | 1892335 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 56 | 730588 | 730773 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 57 | 1008474 | 1008659 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 58 | 985089 | 985274 | + | NZ_CP029476.1 | Lactobacillus apis |
| 59 | 1139596 | 1139781 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 60 | 1056793 | 1056978 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 61 | 131783 | 131968 | + | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 62 | 1712880 | 1713065 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 63 | 1195350 | 1195535 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 64 | 727175 | 727360 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 65 | 746049 | 746234 | - | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 66 | 739862 | 740047 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 67 | 1516090 | 1516275 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 68 | 1292898 | 1293083 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 69 | 840901 | 841086 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 70 | 1076181 | 1076366 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 71 | 806397 | 806582 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 72 | 656906 | 657091 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 73 | 1413997 | 1414182 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 74 | 2112411 | 2112599 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 75 | 860977 | 861162 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 76 | 599909 | 600094 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 77 | 654243 | 654428 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 78 | 741361 | 741546 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 79 | 2171886 | 2172071 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 80 | 1022904 | 1023089 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 81 | 1776133 | 1776321 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 82 | 1557486 | 1557674 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 83 | 621320 | 621508 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 84 | 3413703 | 3413876 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 85 | 1964093 | 1964281 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 86 | 1652102 | 1652290 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 87 | 1552780 | 1552965 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 88 | 1556811 | 1556996 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 89 | 1201324 | 1201509 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 90 | 287203 | 287388 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 91 | 2781397 | 2781582 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 92 | 649173 | 649358 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 93 | 1555488 | 1555676 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 94 | 2806838 | 2807023 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 95 | 1280559 | 1280744 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 96 | 2390643 | 2390831 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 97 | 1849132 | 1849320 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 98 | 1864584 | 1864772 | + | NZ_LT906444.1 | Listeria welshimeri |
| 99 | 1944901 | 1945089 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 100 | 1890951 | 1891139 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 101 | 1033024 | 1033212 | - | NZ_LR134483.1 | Listeria grayi |
| 102 | 1575276 | 1575461 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 103 | 2602418 | 2602606 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 104 | 1259190 | 1259378 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 105 | 3928834 | 3929022 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 106 | 2380189 | 2380377 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 107 | 4202787 | 4202975 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 108 | 977740 | 977928 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 109 | 1734156 | 1734344 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 110 | 2642304 | 2642492 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 111 | 1485208 | 1485396 | - | NZ_CP040336.1 | Bacillus luti |
| 112 | 3744098 | 3744286 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 113 | 3879142 | 3879330 | + | NC_011725.1 | Bacillus cereus B4264 |
| 114 | 3883376 | 3883564 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 115 | 119632 | 119820 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 116 | 1578732 | 1578920 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 117 | 562407 | 562595 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 118 | 1536951 | 1537139 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 119 | 1761480 | 1761668 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 120 | 1784087 | 1784275 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 121 | 1783458 | 1783646 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 122 | 1610321 | 1610509 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 123 | 1833955 | 1834143 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 124 | 1562995 | 1563183 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 125 | 1659695 | 1659883 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 126 | 1622135 | 1622323 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 127 | 1628466 | 1628654 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 128 | 330337 | 330525 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 129 | 1655599 | 1655787 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 130 | 2586038 | 2586226 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 131 | 581916 | 582104 | - | NC_022549.1 | Acholeplasma brassicae |
| 132 | 1528200 | 1528388 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 133 | 3674546 | 3674734 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 134 | 2591416 | 2591604 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 135 | 3295043 | 3295231 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 136 | 1026286 | 1026474 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 137 | 3644295 | 3644483 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 138 | 2350636 | 2350824 | + | NZ_CP011937.1 | Bacillus velezensis |
| 139 | 254754 | 254942 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 140 | 166392 | 166580 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 141 | 966221 | 966409 | - | NZ_LR134484.1 | Gemella haemolysans |
| 142 | 3769975 | 3770163 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 143 | 1480644 | 1480832 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 144 | 1449307 | 1449495 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 145 | 2139406 | 2139594 | - | NZ_CP053989.1 | Niallia circulans |
| 146 | 1917137 | 1917325 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 147 | 313436 | 313624 | - | NZ_CP014159.1 | Aerococcus christensenii |
| 148 | 1678092 | 1678283 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 149 | 1559822 | 1560010 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 150 | 2748885 | 2749073 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 151 | 434578 | 434766 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 152 | 2687940 | 2688128 | + | NZ_LS483476.1 | Lederbergia lentus |
| 153 | 2124859 | 2125047 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 154 | 138705 | 138893 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 155 | 16038 | 16226 | + | NZ_LT906439.1 | Streptococcus merionis |
| 156 | 370417 | 370605 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 157 | 870113 | 870301 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 158 | 672502 | 672690 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 159 | 2079700 | 2079888 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 160 | 776671 | 776859 | + | NZ_CP043405.1 | Streptococcus ratti |
| 161 | 552385 | 552573 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 162 | 2294907 | 2295095 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 163 | 1789757 | 1789945 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 164 | 1640878 | 1641066 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 165 | 2086503 | 2086691 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 166 | 263405 | 263593 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 167 | 1081359 | 1081547 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 168 | 1684440 | 1684628 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 169 | 82815 | 83003 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 170 | 201601 | 201789 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 171 | 653849 | 654037 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 172 | 314219 | 314407 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 173 | 325811 | 325999 | + | NC_012924.1 | Streptococcus suis SC84 |
| 174 | 489565 | 489753 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 175 | 208946 | 209134 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 176 | 276006 | 276194 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 177 | 1681873 | 1682061 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 178 | 2413916 | 2414104 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 179 | 1869768 | 1869956 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 180 | 2623607 | 2623795 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 181 | 561076 | 561264 | + | NZ_CP023011.2 | Enterococcus hirae |
| 182 | 1143978 | 1144163 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 183 | 236882 | 237070 | + | NZ_LS483343.1 | Streptococcus ferus |
| 184 | 1482149 | 1482337 | - | NZ_CP013237.1 | Streptococcus mutans |
| 185 | 127560 | 127748 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 186 | 847620 | 847811 | - | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017326.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03780.15 | 0.92 | 171 | 236 | opposite-strand | Asp23 family, cell envelope-related function |
| 2 | PF13684.8 | 0.95 | 176 | 628.0 | opposite-strand | Dihydroxyacetone kinase family |
| 3 | PF02734.19 | 0.94 | 175 | 628 | opposite-strand | DAK2 domain |
| 4 | PF00271.33 | 0.72 | 133 | 2568 | opposite-strand | Helicase conserved C-terminal domain |
| 5 | PF00270.31 | 0.73 | 135 | 2568 | opposite-strand | DEAD/DEAH box helicase |
| 6 | PF17191.6 | 0.71 | 132 | 2582.5 | opposite-strand | RecG wedge domain |
| 7 | PF04851.17 | 0.73 | 135 | 2568 | opposite-strand | Type III restriction enzyme, res subunit |
| 8 | PF04263.18 | 0.77 | 143 | 221 | opposite-strand | Thiamin pyrophosphokinase, catalytic domain |
| 9 | PF04265.16 | 0.69 | 128 | 222.0 | opposite-strand | Thiamin pyrophosphokinase, vitamin B1 binding domain |
| 10 | PF00834.21 | 0.76 | 141 | 938 | opposite-strand | Ribulose-phosphate 3 epimerase family |
| 11 | PF03193.18 | 0.78 | 145 | 1596 | opposite-strand | RsgA GTPase |
| 12 | PF16745.7 | 0.76 | 141 | 1597 | opposite-strand | RsgA N-terminal domain |
| 13 | PF00069.27 | 0.7 | 130 | 2515.0 | opposite-strand | Protein kinase domain |
| 14 | PF07714.19 | 0.7 | 130 | 2515.0 | opposite-strand | Protein tyrosine and serine/threonine kinase |
| 15 | PF03793.21 | 0.7 | 130 | 2515.0 | opposite-strand | PASTA domain |
++ More..