Result : Q04G74
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L24 |
| NCBI Accession ID | CP000411.1 |
| Organism | Oenococcus oeni (strain ATCC BAA-331 / PSU-1) |
| Left | 578816 |
| Right | 579085 |
| Strand | + |
| Nucleotide Sequence | ATGAATATTAAGACTGGAGATAAAGTCCGCGTGATCGCCGGTAAGGACAAGGGTAAAGAAGGATCAGTTACCAAGGTATTTTTGAAAACTGATCGTGTAATTGTCGAAGGCGTGAACAAAGTCAAAAAACATCAAAAGCCAACCCAGGCAGAGCCTAAGGGTGGAATTATCGAAAAAGAGGCAGCTATCCATGTATCCAATGTGATGCTGCTGGATGCCTCTAAAAAGAAAACAATTCGCGCTAGCAAGCGCGAAAGCAATAAAAAATAA |
| Sequence | MNIKTGDKVRVIAGKDKGKEGSVTKVFLKTDRVIVEGVNKVKKHQKPTQAEPKGGIIEKEAAIHVSNVMLLDASKKKTIRASKRESNKK |
| Source of smORF | Swiss-Prot |
| Function | One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit. {ECO:0000255|HAMAP-Rule:MF_01326}.; One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit. {ECO:0000255|HAMAP-Rule:MF_01326}. |
| Pubmed ID | 17030793 |
| Domain | CDD:412330,CDD:407270 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q04G74 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 436
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 548413 | 548682 | + | NZ_CP014324.1 | Oenococcus oeni |
| 2 | 1103986 | 1104252 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 3 | 338831 | 339139 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 4 | 1521276 | 1521584 | - | NZ_CP014161.1 | Aerococcus urinae |
| 5 | 965185 | 965493 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 6 | 566362 | 566670 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 7 | 917595 | 917903 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 8 | 1279107 | 1279415 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 9 | 429460 | 429768 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 10 | 1712380 | 1712688 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 11 | 2429012 | 2429323 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 12 | 1523003 | 1523311 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 13 | 165740 | 166048 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 14 | 1962258 | 1962566 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 15 | 507480 | 507791 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 16 | 2100808 | 2101119 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 17 | 1849068 | 1849376 | + | NZ_CP042410.1 | Leuconostoc citreum |
| 18 | 136108 | 136419 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 19 | 327964 | 328272 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 20 | 1987619 | 1987927 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 21 | 243298 | 243606 | + | NZ_CP047361.1 | Macrococcus canis |
| 22 | 133491 | 133802 | + | NZ_LS483476.1 | Lederbergia lentus |
| 23 | 804097 | 804405 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 24 | 138972 | 139283 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 25 | 171452 | 171763 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 26 | 147438 | 147749 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 27 | 1287437 | 1287745 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 28 | 1975306 | 1975623 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 29 | 112248 | 112556 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 30 | 2691985 | 2692302 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 31 | 105609 | 105914 | + | NZ_CP017326.1 | Weissella soli |
| 32 | 773661 | 773978 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 33 | 793723 | 794040 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 34 | 2120167 | 2120478 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 35 | 395258 | 395569 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 36 | 4495773 | 4496081 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 37 | 248648 | 248956 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 38 | 204834 | 205142 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 39 | 205518 | 205829 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 40 | 1066691 | 1067002 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 41 | 552181 | 552492 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 42 | 240703 | 241014 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 43 | 2435069 | 2435380 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 44 | 2538085 | 2538396 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 45 | 3789414 | 3789725 | - | NZ_CP011937.1 | Bacillus velezensis |
| 46 | 276844 | 277155 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 47 | 140797 | 141108 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 48 | 141816 | 142127 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 49 | 140558 | 140869 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 50 | 140683 | 140994 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 51 | 110577 | 110888 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 52 | 1868533 | 1868844 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 53 | 140857 | 141168 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 54 | 2578590 | 2578901 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 55 | 2010922 | 2011233 | + | NZ_LT996885.1 | Dialister massiliensis |
| 56 | 114137 | 114448 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 57 | 74374 | 74685 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 58 | 335919 | 336230 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 59 | 146474 | 146782 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 60 | 2971699 | 2972013 | + | NZ_CP026100.1 | Caulobacter flavus |
| 61 | 3439677 | 3439988 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 62 | 51605 | 51916 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 63 | 167300 | 167611 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 64 | 147166 | 147477 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 65 | 166874 | 167185 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 66 | 1436904 | 1437218 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 67 | 4129898 | 4130206 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 68 | 1615255 | 1615566 | - | NZ_CP013661.2 | Planococcus kocurii |
| 69 | 147311 | 147622 | + | NZ_CP019401.1 | Planococcus faecalis |
| 70 | 151826 | 152137 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 71 | 1487390 | 1487701 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 72 | 1404456 | 1404767 | - | NZ_CP043404.1 | Bacillus safensis |
| 73 | 135138 | 135449 | + | NZ_CP016540.2 | Planococcus versutus |
| 74 | 813896 | 814204 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 75 | 840225 | 840536 | - | NZ_CP039456.1 | Changchengzhania lutea |
| 76 | 162020 | 162325 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 77 | 2573363 | 2573674 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 78 | 146562 | 146873 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 79 | 185995 | 186306 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 80 | 144170 | 144481 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 81 | 144798 | 145109 | + | NZ_CP016538.2 | Planococcus maritimus |
| 82 | 144639 | 144950 | + | NZ_CP059540.1 | Planococcus maritimus |
| 83 | 3332957 | 3333268 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 84 | 1751249 | 1751560 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 85 | 255424 | 255735 | + | NZ_CP053989.1 | Niallia circulans |
| 86 | 1335523 | 1335837 | + | NZ_CP013002.1 | Caulobacter henricii |
| 87 | 1606922 | 1607236 | + | NZ_CP027850.1 | Caulobacter segnis |
| 88 | 3549880 | 3550194 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 89 | 1669031 | 1669351 | - | NZ_LR134375.1 | Veillonella dispar |
| 90 | 1612435 | 1612755 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 91 | 1728698 | 1729018 | - | NZ_LR778174.1 | Veillonella parvula |
| 92 | 2547711 | 2548022 | - | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 93 | 1304456 | 1304758 | + | NC_014230.1 | Croceibacter atlanticus HTCC2559 |
| 94 | 149290 | 149601 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 95 | 1376457 | 1376768 | + | NC_013162.1 | Capnocytophaga ochracea DSM 7271 |
| 96 | 2057434 | 2057745 | + | NZ_CP022379.1 | Capnocytophaga sputigena |
| 97 | 4161351 | 4161662 | + | NZ_CP025791.1 | Flavivirga eckloniae |
| 98 | 1670179 | 1670499 | - | NZ_LT906470.1 | Veillonella rodentium |
| 99 | 174292 | 174603 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 100 | 1133628 | 1133909 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 101 | 2118890 | 2119201 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 102 | 1317692 | 1318003 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 103 | 189471 | 189776 | - | NZ_CP046314.1 | Gemella morbillorum |
| 104 | 1452149 | 1452460 | + | NZ_CP015125.1 | Dokdonia donghaensis DSW-1 |
| 105 | 3381551 | 3381862 | + | NZ_CP012898.1 | Algibacter alginicilyticus |
| 106 | 1965262 | 1965573 | + | NZ_CP061703.1 | Mesoflavibacter profundi |
| 107 | 142120 | 142431 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 108 | 1424908 | 1425192 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 109 | 231659 | 231970 | - | NZ_CP007202.1 | Siansivirga zeaxanthinifaciens CC-SAMT-1 |
| 110 | 272997 | 273305 | + | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 111 | 2075111 | 2075419 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 112 | 793988 | 794299 | - | NZ_CP025938.1 | Tamlana carrageenivorans |
| 113 | 2804493 | 2804804 | + | NZ_CP018153.1 | Gramella salexigens |
| 114 | 356145 | 356456 | + | NZ_CP019342.1 | Nonlabens tegetincola |
| 115 | 856073 | 856381 | + | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 116 | 2359713 | 2360021 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 117 | 1673492 | 1673806 | + | NZ_CP042831.1 | Flavobacterium alkalisoli |
| 118 | 2375959 | 2376264 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 119 | 1107673 | 1107984 | + | NZ_AP017313.1 | Mucilaginibacter gotjawali |
| 120 | 650149 | 650457 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 121 | 2938386 | 2938697 | - | NC_008571.1 | Gramella forsetii KT0803 |
| 122 | 260225 | 260539 | - | NZ_CP029186.1 | Flavobacterium album |
| 123 | 141798 | 142112 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 124 | 2047910 | 2048218 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 125 | 596777 | 597091 | - | NZ_CP031188.1 | Flavobacterium arcticum |
| 126 | 825489 | 825761 | + | NZ_CP053348.1 | Winogradskyella forsetii |
| 127 | 795998 | 796270 | + | NZ_CP053351.1 | Winogradskyella schleiferi |
| 128 | 1834608 | 1834916 | - | NC_014363.1 | Olsenella uli DSM 7084 |
| 129 | 2632176 | 2632460 | - | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 130 | 666201 | 666512 | + | NC_017025.1 | Flavobacterium indicum GPTSA100-9 = DSM 17447 |
| 131 | 924256 | 924567 | - | NZ_CP016359.1 | Gramella flava JLT2011 |
| 132 | 3400609 | 3400923 | + | NZ_CP037933.1 | Flavobacterium nackdongense |
| 133 | 406819 | 407103 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 134 | 1881547 | 1881861 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 135 | 3584990 | 3585304 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 136 | 217810 | 218124 | - | NZ_CP034930.1 | Apibacter raozihei |
| 137 | 2350439 | 2350753 | + | NZ_CP043612.1 | Flavobacterium nitrogenifigens |
| 138 | 1907291 | 1907611 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 139 | 2431659 | 2431973 | + | NZ_CP016907.1 | Flavobacterium anhuiense |
| 140 | 409581 | 409895 | - | NZ_CP029255.1 | Flavobacterium crocinum |
| 141 | 402019 | 402333 | - | NC_009441.1 | Flavobacterium johnsoniae UW101 |
| 142 | 126666 | 126932 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 143 | 194666 | 194980 | - | NZ_CP017479.1 | Flavobacterium gilvum |
| 144 | 2475177 | 2475488 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
| 145 | 401648 | 401959 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 146 | 418357 | 418668 | - | NZ_CP028136.1 | Gramella fulva |
| 147 | 865840 | 866148 | - | NZ_CP054494.1 | Flavobacterium columnare |
| 148 | 2038234 | 2038548 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 149 | 1128187 | 1128495 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 150 | 1179777 | 1180091 | + | NZ_CP017688.1 | Flavobacterium crassostreae |
| 151 | 1397253 | 1397564 | + | NZ_LR027382.1 | Alistipes megaguti |
| 152 | 871093 | 871404 | + | NZ_CP019352.1 | Lacinutrix venerupis |
| 153 | 1325085 | 1325396 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 154 | 2272516 | 2272827 | - | NZ_CP019288.1 | Kordia antarctica |
| 155 | 3817003 | 3817317 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 156 | 753861 | 754163 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 157 | 1694528 | 1694839 | + | NZ_CP041637.1 | Formosa sediminum |
| 158 | 1726953 | 1727267 | + | NZ_CP020918.1 | Flavobacterium faecale |
| 159 | 387935 | 388210 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 160 | 2989683 | 2989964 | - | NC_016001.1 | Flavobacterium branchiophilum FL-15 |
| 161 | 725421 | 725735 | + | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 162 | 1976996 | 1977316 | + | NZ_LT906465.1 | Chryseobacterium taklimakanense |
| 163 | 1701621 | 1701929 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 164 | 250623 | 250937 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 165 | 2015284 | 2015598 | + | NZ_CP023671.1 | Clostridium septicum |
| 166 | 829494 | 829808 | - | NZ_CP017774.1 | Flavobacterium commune |
| 167 | 1140951 | 1141271 | - | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 168 | 110692 | 111006 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 169 | 258166 | 258477 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 170 | 256850 | 257128 | + | NZ_CP016786.1 | Clostridium isatidis |
| 171 | 3928398 | 3928712 | - | NZ_CP046670.1 | Alteromonas mediterranea |
| 172 | 4088659 | 4088973 | - | NZ_CP014322.1 | Alteromonas addita |
| 173 | 4297872 | 4298186 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 174 | 1257296 | 1257580 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 175 | 3755178 | 3755492 | - | NZ_CP008849.1 | Alteromonas australica |
| 176 | 5492509 | 5492799 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 177 | 2809508 | 2809822 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
| 178 | 1243473 | 1243781 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 179 | 1155868 | 1156164 | + | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 180 | 3262327 | 3262647 | - | NZ_CP034161.1 | Epilithonimonas vandammei |
| 181 | 1517087 | 1517374 | - | NC_021291.1 | Spiribacter salinus M19-40 |
| 182 | 2969336 | 2969650 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 183 | 974432 | 974746 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 184 | 3131411 | 3131725 | + | NZ_CP034759.1 | Litorilituus sediminis |
| 185 | 1555404 | 1555679 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 186 | 2715808 | 2716125 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 187 | 3602711 | 3603025 | - | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 188 | 283756 | 284070 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 189 | 284246 | 284560 | + | NZ_CP014204.2 | Clostridium baratii |
| 190 | 318635 | 318949 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 191 | 3185250 | 3185567 | + | NZ_AP019657.1 | Vibrio ponticus |
| 192 | 999163 | 999477 | - | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 193 | 314429 | 314713 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 194 | 2850652 | 2850918 | + | NZ_CP040896.1 | Hymenobacter jejuensis |
| 195 | 3768131 | 3768355 | + | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 196 | 5088771 | 5089043 | - | NZ_CP039126.1 | Blautia producta |
| 197 | 1851860 | 1852084 | - | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 198 | 2314598 | 2314885 | + | NZ_CP023777.1 | Chitinophaga caeni |
| 199 | 494699 | 495013 | + | NZ_CP017689.1 | Thalassotalea crassostreae |
| 200 | 666469 | 666789 | + | NC_010794.1 | Methylacidiphilum infernorum V4 |
| 201 | 3059328 | 3059648 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 202 | 109076 | 109354 | + | NZ_CP015581.1 | Tatumella citrea |
| 203 | 4285829 | 4286107 | - | NZ_CP010803.1 | Martelella endophytica |
| 204 | 1387205 | 1387483 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 205 | 5492709 | 5492984 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 206 | 4044989 | 4045252 | - | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
| 207 | 2451020 | 2451334 | + | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 208 | 3587923 | 3588240 | - | NZ_CP040449.1 | Aeromonas simiae |
| 209 | 3609370 | 3609648 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 210 | 461946 | 462224 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 211 | 472052 | 472330 | + | NZ_CP038853.1 | Pantoea vagans |
| 212 | 2445061 | 2445339 | - | NZ_CP049115.1 | Pantoea stewartii |
| 213 | 460647 | 460925 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 214 | 238254 | 238571 | + | NZ_CP028897.1 | Dongshaea marina |
| 215 | 4639976 | 4640257 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 216 | 4420996 | 4421289 | - | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 217 | 1709238 | 1709516 | + | NZ_CP026364.1 | Proteus hauseri |
| 218 | 1538005 | 1538316 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 219 | 275210 | 275443 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 220 | 1376692 | 1376955 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 221 | 4053044 | 4053322 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 222 | 241808 | 242086 | + | NZ_LR134201.1 | Cedecea lapagei |
| 223 | 237286 | 237564 | + | NZ_CP023525.1 | Cedecea neteri |
| 224 | 1439185 | 1439442 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 225 | 1085414 | 1085728 | + | NZ_AP014564.1 | Ichthyobacterium seriolicida |
| 226 | 409262 | 409540 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 227 | 4254088 | 4254366 | - | NZ_CP050150.1 | Hafnia alvei |
| 228 | 174732 | 175010 | + | NZ_CP009056.1 | Frischella perrara |
| 229 | 4363469 | 4363747 | - | NZ_CP043727.1 | Yersinia canariae |
| 230 | 337399 | 337677 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 231 | 4122660 | 4122947 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 232 | 2985069 | 2985356 | - | NZ_CP044060.1 | Aeromonas veronii |
| 233 | 3241382 | 3241669 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 234 | 332744 | 333031 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 235 | 4871643 | 4871921 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 236 | 1680882 | 1681160 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 237 | 776231 | 776545 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 238 | 4294909 | 4295196 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 239 | 1184379 | 1184657 | - | NZ_CP019706.1 | Pantoea alhagi |
| 240 | 406509 | 406787 | + | NZ_CP061511.1 | Mixta calida |
| 241 | 481127 | 481405 | + | NZ_CP026377.1 | Mixta gaviniae |
| 242 | 4230091 | 4230369 | + | NZ_CP028271.1 | Mixta intestinalis |
| 243 | 982256 | 982534 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 244 | 23886 | 24164 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 245 | 3777319 | 3777633 | + | NZ_CP051180.1 | Ferrimonas lipolytica |
| 246 | 312781 | 313059 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 247 | 428011 | 428289 | + | NZ_CP050508.1 | Raoultella terrigena |
| 248 | 4061452 | 4061730 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 249 | 396878 | 397156 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 250 | 409240 | 409557 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 251 | 1313290 | 1313520 | - | NZ_CP071057.1 | Marinicauda algicola |
| 252 | 4805559 | 4805837 | - | NZ_LT906479.1 | Serratia ficaria |
| 253 | 276758 | 277036 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 254 | 2526546 | 2526824 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 255 | 2589236 | 2589514 | - | NZ_CP009787.1 | Yersinia rohdei |
| 256 | 4377560 | 4377838 | - | NZ_CP032487.1 | Yersinia hibernica |
| 257 | 3587948 | 3588226 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 258 | 4673218 | 4673505 | + | NZ_CP042435.1 | Panacibacter ginsenosidivorans |
| 259 | 4451872 | 4452189 | - | NZ_AP022188.1 | Aeromonas media |
| 260 | 2938550 | 2938867 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 261 | 3480626 | 3480904 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 262 | 317940 | 318218 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 263 | 314512 | 314790 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 264 | 3800599 | 3800877 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 265 | 227855 | 228133 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 266 | 2119337 | 2119615 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 267 | 81837 | 82115 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 268 | 3950642 | 3950920 | - | NZ_LR134340.1 | Escherichia marmotae |
| 269 | 1440852 | 1441130 | - | NZ_CP053416.1 | Salmonella bongori |
| 270 | 4042326 | 4042604 | - | NZ_LT615367.1 | Dickeya aquatica |
| 271 | 2368744 | 2369022 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 272 | 3447453 | 3447731 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 273 | 3423460 | 3423738 | - | NZ_AP014857.1 | Escherichia albertii |
| 274 | 456054 | 456332 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 275 | 4175101 | 4175379 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 276 | 4395114 | 4395392 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 277 | 2853661 | 2853939 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 278 | 3590721 | 3590999 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 279 | 425876 | 426154 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 280 | 4865078 | 4865356 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 281 | 4762721 | 4762999 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 282 | 1183305 | 1183583 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 283 | 454883 | 455161 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 284 | 4182593 | 4182871 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 285 | 2453713 | 2454000 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 286 | 797496 | 797810 | + | NZ_CP037899.1 | Methylacidiphilum kamchatkense Kam1 |
| 287 | 153928 | 154203 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 288 | 523243 | 523521 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 289 | 4802032 | 4802310 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 290 | 3477247 | 3477525 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 291 | 4936007 | 4936285 | - | NZ_LR134494.1 | Serratia quinivorans |
| 292 | 5008060 | 5008338 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 293 | 1194958 | 1195236 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 294 | 975098 | 975376 | + | NZ_CP029736.1 | Providencia rettgeri |
| 295 | 3563536 | 3563814 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 296 | 341228 | 341506 | + | NZ_CP071320.1 | Serratia ureilytica |
| 297 | 4841282 | 4841560 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 298 | 1569048 | 1569326 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 299 | 1263177 | 1263455 | - | NZ_CP007230.1 | Yersinia similis |
| 300 | 1325006 | 1325323 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 301 | 374264 | 374542 | + | NZ_LS483470.1 | Leminorella richardii |
| 302 | 4069380 | 4069658 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 303 | 4055524 | 4055802 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 304 | 393206 | 393484 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 305 | 3885800 | 3886078 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 306 | 3431836 | 3432114 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 307 | 4345822 | 4346100 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 308 | 2692037 | 2692315 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 309 | 4442098 | 4442376 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 310 | 4869079 | 4869357 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 311 | 3963155 | 3963433 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 312 | 478104 | 478382 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 313 | 1114318 | 1114596 | - | NZ_CP065640.1 | Serratia rubidaea |
| 314 | 4253118 | 4253429 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 315 | 1465965 | 1466228 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 316 | 3008455 | 3008733 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 317 | 1642745 | 1643020 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 318 | 4386039 | 4386314 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 319 | 2015357 | 2015635 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 320 | 288318 | 288596 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 321 | 1415744 | 1416022 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 322 | 3562544 | 3562822 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 323 | 320213 | 320491 | + | NZ_CP065534.1 | Lonsdalea populi |
| 324 | 139843 | 140157 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 325 | 745884 | 746162 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 326 | 429680 | 429958 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 327 | 1251701 | 1251979 | - | NZ_CP026047.1 | Raoultella planticola |
| 328 | 464784 | 465062 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 329 | 508562 | 508840 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 330 | 1658401 | 1658679 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 331 | 5143185 | 5143463 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 332 | 1314122 | 1314400 | - | NZ_CP011254.1 | Serratia fonticola |
| 333 | 4186132 | 4186410 | - | NZ_CP025799.1 | Dickeya zeae |
| 334 | 381372 | 381650 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 335 | 3319803 | 3320081 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 336 | 4337364 | 4337642 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 337 | 1996777 | 1997091 | + | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 338 | 4231265 | 4231543 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 339 | 2140413 | 2140691 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 340 | 490255 | 490533 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 341 | 482192 | 482470 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 342 | 4401166 | 4401444 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 343 | 4391706 | 4391984 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 344 | 3204511 | 3204789 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 345 | 4738463 | 4738741 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 346 | 1132890 | 1133168 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 347 | 3485353 | 3485631 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 348 | 4101358 | 4101636 | - | NZ_LS483422.1 | Providencia heimbachae |
| 349 | 4272164 | 4272442 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 350 | 6416642 | 6416956 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 351 | 547707 | 547985 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 352 | 3831504 | 3831782 | + | NZ_CP038469.1 | Citrobacter tructae |
| 353 | 2833119 | 2833397 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 354 | 426445 | 426723 | + | NZ_CP041247.1 | Raoultella electrica |
| 355 | 435411 | 435689 | + | NZ_CP054254.1 | Klebsiella variicola |
| 356 | 523670 | 523984 | - | NC_004545.1 | Buchnera aphidicola str. Bp (Baizongia pistaciae) |
| 357 | 3160221 | 3160496 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 358 | 309925 | 310203 | + | NZ_LR134531.1 | Pragia fontium |
| 359 | 158141 | 158419 | + | NZ_CP007445.1 | Gilliamella apicola |
| 360 | 173416 | 173730 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 361 | 2024016 | 2024294 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 362 | 3820187 | 3820474 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 363 | 4198177 | 4198455 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 364 | 4291100 | 4291378 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 365 | 450688 | 450966 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 366 | 4305567 | 4305845 | - | NC_015968.1 | Enterobacter soli |
| 367 | 3008446 | 3008724 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 368 | 4627217 | 4627495 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 369 | 3164690 | 3164965 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 370 | 4892035 | 4892313 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 371 | 710752 | 711030 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 372 | 3823257 | 3823574 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 373 | 462555 | 462833 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 374 | 4585540 | 4585818 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 375 | 4422922 | 4423200 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 376 | 141828 | 142106 | + | NZ_CP046293.1 | Yersinia intermedia |
| 377 | 2072881 | 2073162 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 378 | 4440111 | 4440392 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 379 | 2992554 | 2992832 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 380 | 4033623 | 4033937 | + | NZ_CP067057.1 | Rahnella aceris |
| 381 | 377354 | 377632 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 382 | 906236 | 906547 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 383 | 227579 | 227863 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 384 | 257420 | 257704 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 385 | 4416569 | 4416853 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 386 | 2619803 | 2620117 | + | NZ_CP036200.1 | Shewanella maritima |
| 387 | 4676604 | 4676918 | - | NZ_CP046378.1 | Shewanella algae |
| 388 | 425144 | 425422 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 389 | 128521 | 128799 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 390 | 4095774 | 4096052 | - | NZ_CP048796.1 | Providencia vermicola |
| 391 | 3955740 | 3956054 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 392 | 3329676 | 3329954 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 393 | 4142539 | 4142817 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 394 | 408571 | 408885 | + | NZ_CP014782.1 | Shewanella psychrophila |
| 395 | 91617 | 91928 | + | NZ_CP018804.1 | Histophilus somni |
| 396 | 2369426 | 2369734 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 397 | 2904140 | 2904418 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 398 | 1919039 | 1919353 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 399 | 824890 | 825204 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 400 | 4012647 | 4012958 | - | NZ_CP037951.1 | Parashewanella tropica |
| 401 | 1611613 | 1611843 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 402 | 613416 | 613697 | + | NZ_CP022562.1 | Pseudomonas monteilii |
| 403 | 186684 | 186917 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 404 | 1358376 | 1358651 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 405 | 4761940 | 4762254 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 406 | 304498 | 304776 | + | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 407 | 2256726 | 2257028 | + | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 408 | 2015190 | 2015465 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 409 | 837171 | 837485 | + | NZ_LR134365.1 | Cardiobacterium hominis |
| 410 | 589315 | 589626 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 411 | 617940 | 618215 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 412 | 1089647 | 1089922 | + | NZ_CP028926.1 | Pasteurella multocida |
| 413 | 564900 | 565208 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 414 | 2821405 | 2821722 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 415 | 2277008 | 2277325 | - | NZ_CP035688.1 | Vibrio metoecus |
| 416 | 123875 | 124192 | - | NC_013456.1 | Vibrio antiquarius |
| 417 | 281253 | 281570 | + | NZ_CP030788.1 | Vibrio campbellii |
| 418 | 2995016 | 2995333 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 419 | 1542714 | 1543031 | - | NZ_CP019959.1 | Vibrio owensii |
| 420 | 488954 | 489271 | + | NZ_CP009467.1 | Vibrio harveyi |
| 421 | 1955194 | 1955511 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 422 | 1437431 | 1437739 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 423 | 2850492 | 2850809 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 424 | 3097286 | 3097603 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 425 | 307481 | 307795 | + | NZ_CP040021.1 | Salinivibrio kushneri |
| 426 | 2619254 | 2619571 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 427 | 970905 | 971219 | - | NZ_CP014056.2 | Grimontia hollisae |
| 428 | 456537 | 456851 | - | NZ_CP022355.1 | Paraphotobacterium marinum |
| 429 | 405554 | 405871 | + | NZ_CP046268.1 | Vibrio spartinae |
| 430 | 2618896 | 2619213 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 431 | 256223 | 256540 | + | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 432 | 2544669 | 2544983 | - | NZ_CP033078.1 | Vibrio zhugei |
| 433 | 2460977 | 2461294 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 434 | 2172451 | 2172738 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 435 | 348303 | 348620 | + | NZ_CP047475.1 | Vibrio astriarenae |
| 436 | 2701124 | 2701438 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 437 | 3111282 | 3111596 | - | NZ_AP014635.1 | Vibrio tritonius |
| 438 | 588709 | 589020 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP042371.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00189.22 | 0.95 | 414 | 1413.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 2 | PF07650.19 | 0.95 | 414 | 1413.0 | same-strand | KH domain |
| 3 | PF00252.20 | 0.96 | 419 | 990 | same-strand | Ribosomal protein L16p/L10e |
| 4 | PF00831.25 | 0.96 | 420 | 795.5 | same-strand | Ribosomal L29 protein |
| 5 | PF00366.22 | 0.96 | 420 | 540.0 | same-strand | Ribosomal protein S17 |
| 6 | PF00238.21 | 0.99 | 433 | 37 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00673.23 | 1.0 | 436 | 15.0 | same-strand | ribosomal L5P family C-terminus |
| 8 | PF00281.21 | 1.0 | 435 | 15 | same-strand | Ribosomal protein L5 |
| 9 | PF00410.21 | 1.0 | 435 | 904 | same-strand | Ribosomal protein S8 |
| 10 | PF00347.25 | 0.98 | 429 | 1310 | same-strand | Ribosomal protein L6 |
| 11 | PF00861.24 | 0.92 | 403 | 1854 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 12 | PF00253.23 | 0.93 | 405 | 569 | same-strand | Ribosomal protein S14p/S29e |
++ More..