Result : Q04G25
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000411.1 |
| Organism | Oenococcus oeni (strain ATCC BAA-331 / PSU-1) |
| Left | 624505 |
| Right | 624717 |
| Strand | + |
| Nucleotide Sequence | ATGAATTATATTGCTGCAGGTATTGCTTTATGCGGATCAGCTATTGGTGCTGGTATTGGAAATGGTATGTTGATGGCCAAACTAATTGAGTCCATTGCGCGTCAGCCTGAACTTGAAGGTAATTTGAGGACTAATATGTTCATTTCAATGGCTTTAGTCGAGGCTATGCCGATTATCGTTATTGCTATGTCGTTTGTTTTAATCAACGAATAA |
| Sequence | MNYIAAGIALCGSAIGAGIGNGMLMAKLIESIARQPELEGNLRTNMFISMALVEAMPIIVIAMSFVLINE |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 17030793 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | Q04G25 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 117
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 594087 | 594299 | + | NZ_CP014324.1 | Oenococcus oeni |
| 2 | 1151183 | 1151395 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 3 | 939239 | 939451 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 4 | 2405833 | 2406045 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 5 | 776821 | 777033 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 6 | 942895 | 943107 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 7 | 1787273 | 1787485 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 8 | 882658 | 882870 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 9 | 1668694 | 1668906 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 10 | 108283 | 108501 | + | NZ_CP040336.1 | Bacillus luti |
| 11 | 5043350 | 5043568 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 12 | 5064199 | 5064417 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 13 | 5229627 | 5229845 | - | NC_011725.1 | Bacillus cereus B4264 |
| 14 | 5267343 | 5267561 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 15 | 3889113 | 3889331 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 16 | 4349514 | 4349720 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 17 | 3061902 | 3062126 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 18 | 956564 | 956776 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 19 | 1012431 | 1012643 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 20 | 2074180 | 2074392 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 21 | 832004 | 832225 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 22 | 708338 | 708550 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 23 | 870320 | 870532 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 24 | 51585 | 51797 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 25 | 891148 | 891384 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 26 | 1846748 | 1846960 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 27 | 6363324 | 6363548 | - | NZ_AP019400.1 | Cohnella abietis |
| 28 | 1145478 | 1145693 | - | NZ_CP021434.1 | Tumebacillus avium |
| 29 | 1727052 | 1727279 | - | NZ_LT906470.1 | Veillonella rodentium |
| 30 | 1607928 | 1608140 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 31 | 37198 | 37410 | - | NZ_CP027770.1 | Staphylococcus felis |
| 32 | 505875 | 506087 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 33 | 4893383 | 4893595 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 34 | 896533 | 896739 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 35 | 105949 | 106161 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 36 | 819890 | 820102 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 37 | 1325348 | 1325560 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 38 | 860725 | 860937 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 39 | 609125 | 609337 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 40 | 897916 | 898128 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 41 | 2041914 | 2042126 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 42 | 2128112 | 2128324 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 43 | 2172982 | 2173194 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 44 | 839239 | 839445 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 45 | 1873328 | 1873534 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 46 | 4681534 | 4681719 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 47 | 380075 | 380287 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 48 | 1676101 | 1676313 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 49 | 2365379 | 2365591 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 50 | 911851 | 912087 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 51 | 3260481 | 3260654 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 52 | 3303828 | 3304001 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 53 | 1475049 | 1475249 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 54 | 1392118 | 1392318 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 55 | 2470173 | 2470385 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 56 | 3535807 | 3536028 | - | NZ_CP051883.1 | Aeromonas salmonicida |
| 57 | 5297826 | 5298047 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 58 | 1403822 | 1404037 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 59 | 6645154 | 6645369 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 60 | 1375890 | 1376105 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 61 | 7365336 | 7365554 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 62 | 1437457 | 1437672 | + | NZ_CP023011.2 | Enterococcus hirae |
| 63 | 2079691 | 2079906 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 64 | 607436 | 607648 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 65 | 250698 | 250919 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 66 | 1310902 | 1311114 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 67 | 678812 | 679024 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 68 | 1730133 | 1730354 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 69 | 3824957 | 3825172 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 70 | 764158 | 764373 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 71 | 844326 | 844541 | + | NZ_CP065211.1 | Enterococcus lactis |
| 72 | 2228887 | 2229084 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 73 | 823491 | 823703 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 74 | 4084063 | 4084257 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 75 | 5854257 | 5854472 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 76 | 1360982 | 1361200 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 77 | 1761820 | 1761993 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 78 | 440682 | 440855 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 79 | 6516161 | 6516385 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 80 | 2578090 | 2578302 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 81 | 2499745 | 2499963 | - | NZ_LR134483.1 | Listeria grayi |
| 82 | 4993566 | 4993784 | - | NZ_CP028897.1 | Dongshaea marina |
| 83 | 1392686 | 1392898 | + | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 84 | 4026839 | 4027048 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 85 | 1420391 | 1420603 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 86 | 3404617 | 3404829 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 87 | 2566865 | 2567077 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 88 | 413427 | 413639 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 89 | 2535035 | 2535247 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 90 | 3871792 | 3871992 | - | NZ_CP033433.1 | Cohnella candidum |
| 91 | 187517 | 187729 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 92 | 4224710 | 4224892 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 93 | 3420997 | 3421203 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 94 | 648122 | 648334 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 95 | 1284381 | 1284593 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 96 | 1836019 | 1836234 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 97 | 354437 | 354649 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 98 | 102175 | 102387 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 99 | 89047 | 89259 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 100 | 1111120 | 1111332 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 101 | 528500 | 528718 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 102 | 1263063 | 1263260 | - | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 103 | 1669251 | 1669478 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 104 | 1725074 | 1725301 | - | NZ_LR134375.1 | Veillonella dispar |
| 105 | 1785729 | 1785956 | - | NZ_LR778174.1 | Veillonella parvula |
| 106 | 1613347 | 1613556 | + | NZ_LR134476.1 | Trueperella bialowiezensis |
| 107 | 2851258 | 2851449 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 108 | 130126 | 130317 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 109 | 2488796 | 2488990 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 110 | 2762470 | 2762664 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 111 | 25438 | 25629 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 112 | 47796 | 47984 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 113 | 3392567 | 3392752 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 114 | 3340597 | 3340788 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 115 | 42180 | 42371 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 116 | 3125281 | 3125511 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 117 | 2839601 | 2839831 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040336.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00119.22 | 0.98 | 115 | 47 | same-strand | ATP synthase A chain |
| 2 | PF00430.20 | 0.98 | 115 | 95 | same-strand | ATP synthase B/B' CF(0) |
| 3 | PF00213.20 | 0.95 | 111 | 596 | same-strand | ATP synthase delta (OSCP) subunit |
| 4 | PF00006.27 | 0.98 | 115 | 1934.0 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 5 | PF00306.29 | 0.98 | 115 | 1163 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 6 | PF02874.25 | 0.98 | 115 | 1934.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 7 | PF00231.21 | 0.98 | 115 | 2729 | same-strand | ATP synthase |
| 8 | PF14681.8 | 0.61 | 71 | 2469 | same-strand | Uracil phosphoribosyltransferase |
| 9 | PF03899.17 | 0.61 | 71 | 810 | same-strand | ATP synthase I chain |
++ More..