Result : Q04E63
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 10 kDa chaperonin (GroES protein) (Protein Cpn10) |
| NCBI Accession ID | CP000411.1 |
| Organism | Oenococcus oeni (strain ATCC BAA-331 / PSU-1) |
| Left | 1312682 |
| Right | 1312957 |
| Strand | - |
| Nucleotide Sequence | ATGATCAAACCATTAGGCGATCGAATTGTTCTTAGTATTGACCAACCTGAAGAAGAAAAGGTTGGCGGAATTTTAATTGCAAATAATGCCAAAGAAAAACCAGTGATGGGTTCTGTTGTGGCAATTTCGGAGACAAGTGTTGGAGATTCAAAAGCTCCCAAGTCTGTTAAAGTCGGCGATAAAGTTATGTTTGATAAATATGCCGGTTCTCAAGTTACGATCGACGGGGAAGATTACCTCATTGTTCACGAAAAAGATATTTTGGGGGTATTGTAA |
| Sequence | MIKPLGDRIVLSIDQPEEEKVGGILIANNAKEKPVMGSVVAISETSVGDSKAPKSVKVGDKVMFDKYAGSQVTIDGEDYLIVHEKDILGVL |
| Source of smORF | Swiss-Prot |
| Function | Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter. {ECO:0000255|HAMAP-Rule:MF_00580}. |
| Pubmed ID | 17030793 |
| Domain | CDD:415587 |
| Functional Category | Others |
| Uniprot ID | Q04E63 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 68
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1366389 | 1366664 | - | NZ_CP014324.1 | Oenococcus oeni |
| 2 | 224362 | 224637 | - | NZ_CP029684.2 | Oenococcus sicerae |
| 3 | 573407 | 573682 | + | NZ_CP027563.1 | Weissella confusa |
| 4 | 287381 | 287659 | + | NZ_CP017326.1 | Weissella soli |
| 5 | 470676 | 470951 | + | NZ_CP061835.1 | Weissella viridescens |
| 6 | 255713 | 255988 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 7 | 1573444 | 1573719 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 8 | 1375931 | 1376218 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 9 | 47851 | 48138 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 10 | 1178539 | 1178823 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 11 | 1012100 | 1012384 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 12 | 315106 | 315390 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 13 | 352451 | 352735 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 14 | 1690344 | 1690628 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 15 | 564487 | 564771 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 16 | 583154 | 583438 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 17 | 709299 | 709583 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 18 | 928256 | 928540 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 19 | 1036845 | 1037129 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 20 | 2113626 | 2113910 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 21 | 116600 | 116884 | + | NZ_CP042410.1 | Leuconostoc citreum |
| 22 | 1586720 | 1587004 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 23 | 1962446 | 1962730 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 24 | 1888869 | 1889153 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 25 | 1440296 | 1440580 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 26 | 14857 | 15141 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 27 | 1702713 | 1702997 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 28 | 420341 | 420625 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 29 | 1434476 | 1434760 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 30 | 1358595 | 1358879 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 31 | 669798 | 670082 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 32 | 390163 | 390447 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 33 | 412340 | 412624 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 34 | 764460 | 764744 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 35 | 756972 | 757256 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 36 | 1986153 | 1986437 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 37 | 2614281 | 2614565 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 38 | 379396 | 379680 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 39 | 247140 | 247424 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 40 | 424460 | 424744 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 41 | 211275 | 211559 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 42 | 2503911 | 2504156 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 43 | 2176557 | 2176838 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 44 | 2146155 | 2146436 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 45 | 2177748 | 2178029 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 46 | 423833 | 424075 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 47 | 1399222 | 1399503 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 48 | 2243863 | 2244165 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 49 | 3610458 | 3610688 | - | NZ_CP046603.1 | Lysobacter soli |
| 50 | 154054 | 154338 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 51 | 1799376 | 1799630 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 52 | 4151469 | 4151717 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 53 | 1293169 | 1293402 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 54 | 4361007 | 4361258 | + | NZ_CP009621.1 | Pontibacter korlensis |
| 55 | 581962 | 582216 | + | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 56 | 538570 | 538800 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
| 57 | 512737 | 513021 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 58 | 1273107 | 1273391 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 59 | 1090562 | 1090816 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 60 | 783138 | 783419 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 61 | 3973646 | 3973894 | + | NZ_CP012333.1 | Labilithrix luteola |
| 62 | 3465315 | 3465545 | - | NZ_CP029843.1 | Lysobacter maris |
| 63 | 3638967 | 3639197 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 64 | 287023 | 287256 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 65 | 472691 | 472978 | - | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 66 | 1072062 | 1072319 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 67 | 1798291 | 1798584 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 68 | 2551364 | 2551621 | + | NZ_CP029556.1 | Lysobacter oculi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014324.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00118.26 | 1.0 | 68 | 54.0 | same-strand | TCP-1/cpn60 chaperonin family |
++ More..