ProsmORF-pred
Result : A6V0B2
Protein Information
Information Type Description
Protein name UPF0250 protein PSPA7_1111
NCBI Accession ID CP000744.1
Organism Pseudomonas aeruginosa (strain PA7)
Left 1109775
Right 1110056
Strand +
Nucleotide Sequence ATGACCGATACCCCTGACGTTCAACCCCCGAAAATCGAATTCCCCTGCGAGCGCTACCCGATCAAGGTGATCGGCGACGCCGGCGAAGGTTTCTCCGACCTGGTCGTGGAAATCATCCGGCGCCATGCGCCAGACCTCGACGCCGAGACCCTGGTGGTCCGCGACAGCAGCAAGGGGCGCTTCCTCTCGGTGCAGGTGCTGATCACCGCCACCGATGTCGACCAACTGCAAGCCATCCATAACGACCTGCGCGCGACCGGACGCGTGCACATGGTGCTCTGA
Sequence MTDTPDVQPPKIEFPCERYPIKVIGDAGEGFSDLVVEIIRRHAPDLDAETLVVRDSSKGRFLSVQVLITATDVDQLQAIHNDLRATGRVHMVL
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl01102. Profile Description: Protein of unknown function (DUF493). hypothetical protein; Provisional
Pubmed ID
Domain CDD:412741
Functional Category Others
Uniprot ID A6V0B2
ORF Length (Amino Acid) 93
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 72
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 4478627 4478908 - NC_002516.2 Pseudomonas aeruginosa PAO1
2 759578 759859 + NZ_CP043311.1 Pseudomonas lalkuanensis
3 808129 808410 + NZ_AP014862.1 Pseudomonas furukawaii
4 997543 997821 + NZ_AP022642.1 Pseudomonas otitidis
5 4466585 4466863 - NZ_CP068551.1 Pseudomonas khazarica
6 802053 802331 + NC_012560.1 Azotobacter vinelandii DJ
7 927905 928183 + NZ_CP013124.1 Pseudomonas mendocina S5.2
8 1181004 1181282 + NZ_CP060009.1 Pseudomonas sediminis
9 3625307 3625585 + NZ_CP045302.1 Azotobacter salinestris
10 1316483 1316761 - NZ_CP070505.1 Pseudomonas toyotomiensis
11 6330222 6330521 - NZ_CP048833.1 Pseudomonas multiresinivorans
12 3752254 3752532 - NZ_CP011835.1 Azotobacter chroococcum
13 941269 941559 + NZ_CP014158.1 Pseudomonas citronellolis
14 777020 777310 + NZ_CP047698.1 Pseudomonas knackmussii
15 3706243 3706521 - NZ_LR215729.2 Pseudomonas marincola
16 789395 789676 - NZ_CP012362.1 Oblitimonas alkaliphila
17 2333537 2333809 + NZ_CP029822.1 Entomomonas moraniae
18 935895 936167 + NC_010995.1 Cellvibrio japonicus Ueda107
19 540925 541197 + NZ_CP043869.1 Neptunomonas concharum
20 609040 609312 + NZ_CP015839.1 Marinobacterium aestuarii
21 1947839 1948120 + NZ_CP014143.1 Microbulbifer aggregans
22 3056651 3056923 - NC_020888.1 Thalassolituus oleivorans MIL-1
23 464022 464303 + NZ_AP014545.1 Amphritea japonica ATCC BAA-1530
24 5988206 5988481 - NZ_CP014870.1 Pseudomonas silesiensis
25 943282 943551 + NZ_CP011494.1 Marinobacter psychrophilus
26 1592084 1592356 - NC_018868.3 Simiduia agarivorans SA1 = DSM 21679
27 5458128 5458403 - NC_004578.1 Pseudomonas syringae pv. tomato str. DC3000
28 5876918 5877193 - NZ_CP035088.1 Pseudomonas viciae
29 6009851 6010126 - NZ_CP061079.1 Pseudomonas chlororaphis
30 5152597 5152872 - NZ_CP068034.2 Pseudomonas syringae
31 2727739 2728014 - NZ_CP014262.1 Pseudomonas corrugata
32 5226081 5226356 - NZ_CP007039.1 Pseudomonas cichorii JBC1
33 4722405 4722674 - NZ_CP021425.1 Oleiphilus messinensis
34 5041756 5042031 + NZ_CP048810.1 Pseudomonas bijieensis
35 3413127 3413396 - NZ_CP036422.1 Halioglobus maricola
36 630230 630499 + NC_017506.1 Marinobacter adhaerens HP15
37 5916617 5916892 - NZ_CP034725.1 Pseudomonas brassicacearum
38 3971244 3971531 - NZ_CP023559.1 Salinicola tamaricis
39 6036543 6036818 - NZ_LS999205.1 Pseudomonas protegens CHA0
40 1618198 1618464 + NZ_CP048602.1 Halomonas piezotolerans
41 5135580 5135855 - NZ_CP067022.1 Pseudomonas cannabina pv. alisalensis
42 668036 668308 + NZ_CP020038.1 Agarilytica rhodophyticola
43 5216178 5216453 - NZ_CP042804.1 Pseudomonas amygdali pv. tabaci str. ATCC 11528
44 916691 916966 + NZ_CP070503.1 Pseudomonas atacamensis
45 4264498 4264770 - NC_007912.1 Saccharophagus degradans 2-40
46 1704864 1705175 + NZ_CP065135.1 Halomonas venusta
47 1079504 1079773 + NZ_CP043042.1 Marinobacter fonticola
48 2818631 2818906 - NZ_CP031146.1 Pseudomonas plecoglossicida
49 338325 338603 - NZ_CP060092.1 Teredinibacter purpureus
50 1763097 1763393 + NC_007963.1 Chromohalobacter salexigens DSM 3043
51 5512946 5513221 - NC_021505.1 Pseudomonas putida NBRC 14164
52 1622968 1623279 + NZ_AP022843.1 Halomonas hydrothermalis
53 5677657 5677932 - NZ_CP056030.1 Pseudomonas eucalypticola
54 3326416 3326694 + NZ_CP059082.1 Halomonas titanicae
55 5762316 5762591 + NZ_CP009365.1 Pseudomonas soli
56 5239326 5239601 - NZ_CP022562.1 Pseudomonas monteilii
57 5893297 5893572 - NZ_CP014205.2 Pseudomonas glycinae
58 5527890 5528165 - NZ_CP029608.1 Pseudomonas kribbensis
59 5730411 5730686 - NZ_CP062253.1 Pseudomonas gozinkensis
60 5747307 5747582 - NZ_CP062252.1 Pseudomonas allokribbensis
61 5370707 5370982 - NZ_CP010896.1 Pseudomonas simiae
62 2434608 2434877 - NZ_CP017715.1 Marinobacter salinus
63 5072599 5072874 - NZ_CP024159.1 Pseudomonas mosselii
64 5124636 5124911 - NC_008027.1 Pseudomonas entomophila L48
65 5076521 5076793 - NZ_CP071706.1 Pseudomonas donghuensis
66 5746888 5747163 - NZ_CP027756.1 Pseudomonas synxantha
67 5155459 5155734 - NZ_CP027723.1 Pseudomonas orientalis
68 4254952 4255227 + NZ_CP009533.1 Pseudomonas rhizosphaerae
69 3384871 3385137 - NZ_CP014544.1 Zhongshania aliphaticivorans
70 5343632 5343910 - NZ_CP048878.1 Spartinivicinus ruber
71 1200296 1200571 - NC_017856.1 Methylophaga frappieri
72 787086 787358 + NZ_CP046621.1 Pseudomonas alkylphenolica
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_002516.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF04055.23 0.9 65 650 same-strand Radical SAM superfamily
2 PF00768.22 1.0 72 83.0 same-strand D-alanyl-D-alanine carboxypeptidase
3 PF07943.15 1.0 72 83.0 same-strand Penicillin-binding protein 5, C-terminal domain
4 PF03330.20 0.99 71 1423 same-strand Lytic transglycolase
5 PF05036.15 0.93 67 1423 same-strand SPOR domain
6 PF13406.8 0.94 68 2447 same-strand Transglycosylase SLT domain
7 PF01098.21 0.97 70 3460.0 same-strand Cell cycle protein
8 PF00905.24 0.89 64 4595.5 same-strand Penicillin binding protein transpeptidase domain
9 PF03717.17 0.88 63 4595 same-strand Penicillin-binding Protein dimerisation domain
++ More..