Result : Q049Z7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0346 protein LBUL_1194 |
| NCBI Accession ID | CP000412.1 |
| Organism | Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) |
| Left | 1099704 |
| Right | 1099934 |
| Strand | - |
| Nucleotide Sequence | ATGGCCTACCGACAAAGTTTTTACCAGTTTTTGATGACTTTGCGCGATCCGGATTCAAATGGCGACCTGGCCCAGTTTGCCAACAACGCCCAGTTTGACTCGACCTTTCCCAGACAGGAACAGGACCGGACCAGGCTGTCAGAATATCTGGAGGAAAATGCCGCTTACCTGCCCAGCATGACGATTTTTGACGATGCTTACCAGGCTTATGAAGAGAAAATGCAGTACTAG |
| Sequence | MAYRQSFYQFLMTLRDPDSNGDLAQFANNAQFDSTFPRQEQDRTRLSEYLEENAAYLPSMTIFDDAYQAYEEKMQY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 17030793 |
| Domain | CDD:416295 |
| Functional Category | Others |
| Uniprot ID | Q049Z7 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1076570 | 1076800 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 2 | 727372 | 727602 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 3 | 950218 | 950448 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 4 | 771139 | 771369 | + | NZ_CP029476.1 | Lactobacillus apis |
| 5 | 1259891 | 1260121 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 6 | 960252 | 960482 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 7 | 776799 | 777029 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 8 | 1061946 | 1062173 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 9 | 964565 | 964795 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 10 | 1160186 | 1160416 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 11 | 896787 | 897017 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 12 | 937770 | 937994 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 13 | 909443 | 909670 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 14 | 1114368 | 1114595 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 15 | 1041884 | 1042078 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 16 | 819108 | 819335 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 17 | 1125392 | 1125586 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 18 | 753698 | 753925 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 19 | 676174 | 676368 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 20 | 1531183 | 1531383 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 21 | 857501 | 857695 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 22 | 1123079 | 1123306 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 23 | 468065 | 468262 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 24 | 1957595 | 1957789 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 25 | 985164 | 985361 | + | NZ_CP049366.1 | Companilactobacillus pabuli |
| 26 | 1346503 | 1346700 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 27 | 1305517 | 1305711 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 28 | 1445262 | 1445459 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 29 | 2727045 | 2727236 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 30 | 1131202 | 1131399 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
| 31 | 959061 | 959255 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 32 | 1514981 | 1515175 | + | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 33 | 840856 | 841083 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 34 | 1926360 | 1926554 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 35 | 1205521 | 1205718 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 36 | 1796473 | 1796670 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 37 | 1337532 | 1337726 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 38 | 735710 | 735904 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 39 | 2061058 | 2061249 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 40 | 420984 | 421181 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 41 | 1618981 | 1619172 | + | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 42 | 1275131 | 1275325 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 43 | 1346829 | 1347044 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 44 | 759455 | 759652 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 45 | 798631 | 798825 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 46 | 1298323 | 1298532 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 47 | 1336881 | 1337090 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 48 | 1038306 | 1038503 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 49 | 980067 | 980258 | + | NZ_CP024610.1 | Lactobacillus terrae |
| 50 | 2748481 | 2748675 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 51 | 825189 | 825419 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 52 | 671550 | 671744 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 53 | 2435831 | 2436022 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 54 | 917269 | 917463 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 55 | 927651 | 927845 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 56 | 2031922 | 2032113 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 57 | 1899775 | 1899963 | - | NZ_CP018906.1 | Lentilactobacillus curieae |
| 58 | 1889014 | 1889208 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 59 | 2019234 | 2019464 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 60 | 1136797 | 1136994 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 61 | 2927782 | 2927976 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 62 | 938092 | 938283 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 63 | 942068 | 942262 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
| 64 | 670789 | 670980 | + | NZ_CP042410.1 | Leuconostoc citreum |
| 65 | 1449864 | 1450058 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 66 | 960920 | 961111 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 67 | 732981 | 733172 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 68 | 1906682 | 1906888 | - | NZ_LT906444.1 | Listeria welshimeri |
| 69 | 1987092 | 1987298 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 70 | 1933037 | 1933243 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 71 | 171041 | 171238 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 72 | 1483956 | 1484165 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 73 | 221517 | 221708 | - | NZ_CP042374.1 | Leuconostoc carnosum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP044534.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02481.17 | 0.67 | 49 | 1707 | same-strand | DNA recombination-mediator protein A |
| 2 | PF01351.20 | 0.81 | 59 | 889 | same-strand | Ribonuclease HII |
| 3 | PF02645.18 | 0.78 | 57 | 1631 | same-strand | Uncharacterised protein, DegV family COG1307 |
| 4 | PF13472.8 | 0.75 | 55 | 652.5 | same-strand | GDSL-like Lipase/Acylhydrolase family |
| 5 | PF00657.24 | 0.75 | 55 | 652.5 | same-strand | GDSL-like Lipase/Acylhydrolase |
| 6 | PF09911.11 | 0.75 | 55 | 39 | same-strand | Uncharacterized protein conserved in bacteria (DUF2140) |
++ More..