Result : Q04811
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YmxH (ORFZ) |
| NCBI Accession ID | L08471.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1221 |
| Right | 1478 |
| Strand | + |
| Nucleotide Sequence | ATGCGGCTCAGTGAATTATCGGGAAAGGAAATTGTAGACATCAAAAGAGCTGAACGGCTCGGAGTGCTCGGCCAGACCGATTTGGAAATCAATGAACAGGATGGACAGATTACAGCACTCCTCATTCCCACAGTTAAGTGGTTTGGTTTGAGAAAGCAAGGTCATGACATTCGTGTCCCATGGCACCATATTCAAAAGATCGGTTCAGATATGATTATATTAGATGTACCTGAGGAAATGCCTCCTCGACAAGAGTAA |
| Sequence | MRLSELSGKEIVDIKRAERLGVLGQTDLEINEQDGQITALLIPTVKWFGLRKQGHDIRVPWHHIQKIGSDMIILDVPEEMPPRQE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21591. Profile Description: N/A. The PRC-barrel is an all beta barrel domain found in photosystem reaction centre subunit H of the purple bacteria and RNA metabolism proteins of the RimM group. PRC-barrels are approximately 80 residues long, and found widely represented in bacteria, archaea and plants. This domain is also present at the carboxyl terminus of the pan-bacterial protein RimM, which is involved in ribosomal maturation and processing of 16S rRNA. A family of small proteins conserved in all known euryarchaea are composed entirely of a single stand-alone copy of the domain. |
| Pubmed ID | 8098035 9384377 |
| Domain | CDD:419751 |
| Functional Category | Others |
| Uniprot ID | Q04811 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 64
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1743924 | 1744181 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1651578 | 1651835 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1711715 | 1711972 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1922457 | 1922714 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1716778 | 1717035 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 1748064 | 1748321 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2262322 | 2262579 | - | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 1698545 | 1698802 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 241952 | 242209 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 10 | 47213 | 47485 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 3655327 | 3655599 | - | NZ_CP043404.1 | Bacillus safensis |
| 12 | 1652999 | 1653271 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 1878769 | 1879026 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 1856982 | 1857242 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 1879631 | 1879891 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 16 | 2294828 | 2295088 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 3326884 | 3327144 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 2143524 | 2143766 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 19 | 1288325 | 1288567 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 20 | 374184 | 374426 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 21 | 738052 | 738294 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 22 | 2694506 | 2694748 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 23 | 689791 | 690030 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 24 | 2081922 | 2082164 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 25 | 4889389 | 4889595 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 26 | 2718830 | 2719069 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 27 | 1841654 | 1841899 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 28 | 1501905 | 1502144 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 29 | 1873252 | 1873488 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 30 | 1109238 | 1109474 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 31 | 3919028 | 3919294 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 32 | 1744768 | 1745019 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 33 | 4308705 | 4308974 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 34 | 884542 | 884811 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 35 | 2496724 | 2496981 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 36 | 2496091 | 2496330 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 37 | 1805944 | 1806183 | - | NZ_CP012024.1 | Bacillus smithii |
| 38 | 2596750 | 2597004 | - | NZ_LS483476.1 | Lederbergia lentus |
| 39 | 1542875 | 1543126 | + | NZ_CP040336.1 | Bacillus luti |
| 40 | 213616 | 213861 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 41 | 2025112 | 2025354 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 42 | 2525913 | 2526161 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 43 | 3686364 | 3686615 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 44 | 3825656 | 3825907 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 45 | 2544487 | 2544738 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 46 | 1626378 | 1626614 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 47 | 1862632 | 1862871 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 48 | 2647917 | 2648147 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 49 | 3834166 | 3834408 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 50 | 3821404 | 3821655 | - | NC_011725.1 | Bacillus cereus B4264 |
| 51 | 2268883 | 2269125 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 52 | 3616828 | 3617079 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 53 | 3481663 | 3481902 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 54 | 1763042 | 1763287 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 55 | 3228177 | 3228410 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 56 | 1646081 | 1646311 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 57 | 412547 | 412783 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 58 | 2502268 | 2502504 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 59 | 1345987 | 1346217 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 60 | 570702 | 570938 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 61 | 576032 | 576268 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 62 | 833931 | 834176 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 63 | 2638699 | 2638956 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 64 | 2628208 | 2628453 | - | NZ_CP019870.1 | Clostridioides difficile |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06574.14 | 0.8 | 51 | 5209 | same-strand | FAD synthetase |
| 2 | PF01687.19 | 0.8 | 51 | 5209 | same-strand | Riboflavin kinase |
| 3 | PF00312.24 | 0.95 | 61 | 4809 | same-strand | Ribosomal protein S15 |
| 4 | PF01138.23 | 0.97 | 62 | 2507.5 | same-strand | 3' exoribonuclease family, domain 1 |
| 5 | PF03725.17 | 0.97 | 62 | 2507.5 | same-strand | 3' exoribonuclease family, domain 2 |
| 6 | PF03726.16 | 0.97 | 62 | 2507.5 | same-strand | Polyribonucleotide nucleotidyltransferase, RNA binding domain |
| 7 | PF00575.25 | 0.97 | 62 | 2507.5 | same-strand | S1 RNA binding domain |
| 8 | PF00013.31 | 0.97 | 62 | 2507.5 | same-strand | KH domain |
| 9 | PF01522.23 | 0.95 | 61 | 1375 | same-strand | Polysaccharide deacetylase |
| 10 | PF00675.22 | 0.97 | 62 | 101.5 | same-strand | Insulinase (Peptidase family M16) |
| 11 | PF05193.23 | 0.97 | 62 | 101.5 | same-strand | Peptidase M16 inactive domain |
| 12 | PF16924.7 | 0.94 | 60 | 188.5 | same-strand | Dipicolinate synthase subunit A N-terminal domain |
| 13 | PF02774.20 | 0.86 | 55 | 1816 | same-strand | Semialdehyde dehydrogenase, dimerisation domain |
| 14 | PF01118.26 | 0.86 | 55 | 1816 | same-strand | Semialdehyde dehydrogenase, NAD binding domain |
| 15 | PF00696.30 | 0.92 | 59 | 2922 | same-strand | Amino acid kinase family |
| 16 | PF13840.8 | 0.92 | 59 | 2922 | same-strand | ACT domain |
| 17 | PF00701.24 | 0.84 | 54 | 4187.5 | same-strand | Dihydrodipicolinate synthetase family |
++ More..