Result : Q047K9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | D-alanyl carrier protein (DCP) (D-alanine--poly(phosphoribitol) ligase subunit 2) |
| NCBI Accession ID | CP000412.1 |
| Organism | Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) |
| Left | 1806449 |
| Right | 1806691 |
| Strand | - |
| Nucleotide Sequence | ATGGATATTCAAAAGCAAATCGTTGACATTTTAGCTGAAGCAACTGGTGAAGACTTCTCAGACAACATGGACCAAGAACTTTACGAGAGCGGGATCATGGACTCCATGACCACTGTGCAGATGCTCTTGACCCTGCAGGAAACCTTCGACATCACCGTTCCGGTTTCTGAATTCAACCGCGACGACTGGAACACCCCGAACAAGCTGGTTGAACAGGTGAAGAAACTGCAAGATGAAGAATAA |
| Sequence | MDIQKQIVDILAEATGEDFSDNMDQELYESGIMDSMTTVQMLLTLQETFDITVPVSEFNRDDWNTPNKLVEQVKKLQDEE |
| Source of smORF | Swiss-Prot |
| Function | Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall. {ECO:0000255|HAMAP-Rule:MF_00565}. |
| Pubmed ID | 17030793 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q047K9 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1839003 | 1839245 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 2 | 1333151 | 1333390 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 3 | 2019576 | 2019815 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 4 | 1932426 | 1932665 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 5 | 1980772 | 1981011 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 6 | 2114026 | 2114265 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 7 | 1802481 | 1802720 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 8 | 1804524 | 1804763 | - | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 9 | 1845396 | 1845635 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 10 | 1813384 | 1813623 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 11 | 1972526 | 1972765 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 12 | 1952423 | 1952659 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 13 | 1855998 | 1856234 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 14 | 1618410 | 1618649 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 15 | 1758568 | 1758804 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 16 | 211690 | 211929 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 17 | 1663458 | 1663694 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 18 | 1649762 | 1650001 | - | NZ_CP029476.1 | Lactobacillus apis |
| 19 | 293190 | 293426 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 20 | 358498 | 358734 | + | NZ_CP042410.1 | Leuconostoc citreum |
| 21 | 680018 | 680254 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
| 22 | 470835 | 471071 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 23 | 146317 | 146550 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 24 | 446496 | 446735 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 25 | 788329 | 788568 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 26 | 806030 | 806269 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 27 | 31836 | 32075 | + | NZ_CP013237.1 | Streptococcus mutans |
| 28 | 1948416 | 1948655 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 29 | 56725 | 56964 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 30 | 615016 | 615210 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 31 | 294372 | 294611 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 32 | 286785 | 287024 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 33 | 1689401 | 1689637 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 34 | 293857 | 294096 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 35 | 272387 | 272626 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 36 | 303315 | 303554 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 37 | 1203791 | 1204027 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 38 | 1719290 | 1719526 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 39 | 882414 | 882647 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 40 | 244409 | 244651 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 41 | 1875666 | 1875899 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 42 | 270293 | 270529 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 43 | 1734462 | 1734704 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 44 | 1880697 | 1880933 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 45 | 2060228 | 2060464 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 46 | 1476066 | 1476302 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 47 | 907875 | 908078 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 48 | 1458322 | 1458558 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 49 | 1205236 | 1205472 | + | NZ_CP046037.1 | Latilactobacillus sakei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP059276.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04914.14 | 0.98 | 46 | -7.0 | same-strand | DltD protein |
| 2 | PF00501.30 | 1.0 | 47 | 1251 | same-strand | AMP-binding enzyme |
| 3 | PF12459.10 | 0.74 | 35 | 2801 | same-strand | D-Ala-teichoic acid biosynthesis protein |
| 4 | PF13193.8 | 0.7 | 33 | 1242 | same-strand | AMP-binding enzyme C-terminal domain |
++ More..