Result : Q045Q9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 10 kDa chaperonin (GroES protein) (Protein Cpn10) |
| NCBI Accession ID | CP000413.1 |
| Organism | Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / AM63) |
| Left | 425208 |
| Right | 425492 |
| Strand | + |
| Nucleotide Sequence | GTGTTACAACCAATTGGTGATCGCGTAATCGTTAAAGTAAAAGACGAAGAAGAAGAAAAAGTTGGAGGCATTGTCCTGGCTTCTAACGCTAAAGAAAAGCCTCAAATGGGTGAAATTATTGCCGTAGGAAATGGTAAGCGTAACGCAAACGGCGACTTAATTCCTATGTCAGTTGCAAAAGGTGAAACAGTATTCTTTGATAAATACTCTGGCACTAACTTGAAATACGAAGGCGAAAAGTATTTAGTACTTCGTGAAAGCGACTTATTAGCTGTCGTTAAGTAA |
| Sequence | MLQPIGDRVIVKVKDEEEEKVGGIVLASNAKEKPQMGEIIAVGNGKRNANGDLIPMSVAKGETVFFDKYSGTNLKYEGEKYLVLRESDLLAVVK |
| Source of smORF | Swiss-Prot |
| Function | Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter. {ECO:0000255|HAMAP-Rule:MF_00580}. |
| Pubmed ID | 17030793 |
| Domain | CDD:415587 |
| Functional Category | Others |
| Uniprot ID | Q045Q9 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 259
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 468027 | 468311 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 2 | 425208 | 425492 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 3 | 424277 | 424561 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 4 | 335149 | 335433 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 5 | 1145751 | 1146035 | - | NZ_CP029476.1 | Lactobacillus apis |
| 6 | 438621 | 438905 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 7 | 1443926 | 1444186 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 8 | 379396 | 379680 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 9 | 450867 | 451151 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 10 | 1452745 | 1453029 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 11 | 1295101 | 1295385 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 12 | 1381830 | 1382114 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 13 | 485602 | 485886 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 14 | 1178539 | 1178823 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 15 | 1151726 | 1152010 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 16 | 315106 | 315390 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 17 | 1986153 | 1986437 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 18 | 469476 | 469760 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 19 | 215371 | 215655 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 20 | 424460 | 424744 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 21 | 1198530 | 1198814 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 22 | 583154 | 583438 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 23 | 564487 | 564771 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 24 | 45067 | 45348 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 25 | 1012100 | 1012384 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 26 | 1586720 | 1587004 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 27 | 1962446 | 1962730 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 28 | 1888869 | 1889153 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 29 | 1814032 | 1814316 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 30 | 1428176 | 1428460 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 31 | 1036845 | 1037129 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 32 | 47851 | 48138 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 33 | 414359 | 414643 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 34 | 764460 | 764744 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 35 | 2113626 | 2113910 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 36 | 840646 | 840930 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 37 | 2122782 | 2123066 | - | NZ_LT906444.1 | Listeria welshimeri |
| 38 | 2149348 | 2149632 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 39 | 503773 | 504057 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 40 | 1358595 | 1358879 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 41 | 2272999 | 2273283 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 42 | 2198024 | 2198305 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 43 | 2295645 | 2295929 | - | NZ_CP065211.1 | Enterococcus lactis |
| 44 | 1671919 | 1672203 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 45 | 1375931 | 1376218 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 46 | 2113465 | 2113749 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 47 | 2216524 | 2216808 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 48 | 1690344 | 1690628 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 49 | 2614281 | 2614565 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 50 | 2231787 | 2232071 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 51 | 1517559 | 1517843 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 52 | 466151 | 466435 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 53 | 467734 | 468018 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 54 | 169053 | 169337 | - | NZ_CP023011.2 | Enterococcus hirae |
| 55 | 412340 | 412624 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 56 | 574786 | 575070 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 57 | 760334 | 760618 | + | NZ_LS483476.1 | Lederbergia lentus |
| 58 | 255723 | 256007 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 59 | 156171 | 156455 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 60 | 928256 | 928540 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 61 | 2529353 | 2529637 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 62 | 1394000 | 1394284 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 63 | 392283 | 392567 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 64 | 532762 | 533046 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 65 | 268953 | 269237 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 66 | 258543 | 258827 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 67 | 261813 | 262097 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 68 | 473252 | 473536 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 69 | 390163 | 390447 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 70 | 424846 | 425130 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 71 | 2495714 | 2495998 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 72 | 986212 | 986496 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 73 | 420341 | 420625 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 74 | 257093 | 257377 | + | NC_011725.1 | Bacillus cereus B4264 |
| 75 | 488686 | 488970 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 76 | 2234178 | 2234450 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 77 | 4128001 | 4128288 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 78 | 4860982 | 4861266 | - | NZ_CP040336.1 | Bacillus luti |
| 79 | 947656 | 947940 | - | NZ_CP043404.1 | Bacillus safensis |
| 80 | 1376829 | 1377113 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 81 | 1901385 | 1901669 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 82 | 5714705 | 5714986 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 83 | 211275 | 211559 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 84 | 816579 | 816863 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 85 | 709299 | 709583 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 86 | 352451 | 352735 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 87 | 2759086 | 2759370 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 88 | 1440296 | 1440580 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 89 | 1399222 | 1399503 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 90 | 2264983 | 2265267 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 91 | 224017 | 224301 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 92 | 2238964 | 2239248 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 93 | 1520669 | 1520953 | + | NZ_AP019400.1 | Cohnella abietis |
| 94 | 818816 | 819073 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 95 | 2605884 | 2606168 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 96 | 1528888 | 1529169 | + | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 97 | 758179 | 758463 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 98 | 476289 | 476546 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 99 | 1635855 | 1636145 | + | NZ_AP014924.1 | Limnochorda pilosa |
| 100 | 4618027 | 4618275 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 101 | 31399 | 31671 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 102 | 1040056 | 1040340 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 103 | 709325 | 709609 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 104 | 400999 | 401283 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 105 | 1348939 | 1349223 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 106 | 409962 | 410252 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 107 | 1157052 | 1157336 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 108 | 2499811 | 2500101 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 109 | 594609 | 594890 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 110 | 570927 | 571211 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 111 | 244584 | 244868 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 112 | 3938570 | 3938860 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 113 | 2858304 | 2858588 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 114 | 803057 | 803347 | + | NZ_CP033614.1 | Leptospira kmetyi |
| 115 | 611881 | 612162 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 116 | 770487 | 770777 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 117 | 1028854 | 1029135 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 118 | 1713916 | 1714206 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 119 | 2454655 | 2454945 | - | NZ_CP030142.1 | Leptospira mayottensis |
| 120 | 3105136 | 3105426 | + | NZ_CP040840.1 | Leptospira weilii |
| 121 | 640136 | 640426 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 122 | 1744743 | 1744991 | - | NC_017856.1 | Methylophaga frappieri |
| 123 | 2576025 | 2576309 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 124 | 5638319 | 5638600 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 125 | 264731 | 265015 | + | NZ_CP034118.1 | Staphylospora marina |
| 126 | 552155 | 552439 | + | NZ_CP059540.1 | Planococcus maritimus |
| 127 | 539070 | 539354 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 128 | 549937 | 550221 | + | NZ_CP016538.2 | Planococcus maritimus |
| 129 | 597676 | 597936 | + | NZ_CP042430.1 | Baekduia soli |
| 130 | 5019788 | 5020069 | - | NC_017082.1 | Bradyrhizobium cosmicum |
| 131 | 521723 | 522007 | + | NZ_CP016540.2 | Planococcus versutus |
| 132 | 538376 | 538660 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 133 | 1216565 | 1216849 | - | NZ_CP013661.2 | Planococcus kocurii |
| 134 | 548708 | 548992 | + | NZ_CP019401.1 | Planococcus faecalis |
| 135 | 575839 | 576123 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 136 | 2126657 | 2126929 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 137 | 512737 | 513021 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 138 | 2022075 | 2022359 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 139 | 431913 | 432224 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 140 | 699288 | 699551 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 141 | 2083673 | 2083957 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 142 | 1585513 | 1585785 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 143 | 985213 | 985497 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 144 | 4972292 | 4972549 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 145 | 2001516 | 2001827 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 146 | 3729942 | 3730226 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 147 | 23099 | 23383 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 148 | 1994052 | 1994363 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 149 | 7989797 | 7990078 | + | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 150 | 4235818 | 4236129 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 151 | 1615919 | 1616203 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 152 | 45821 | 46105 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 153 | 3093573 | 3093827 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 154 | 803076 | 803357 | + | NZ_LR134483.1 | Listeria grayi |
| 155 | 14857 | 15141 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 156 | 1702713 | 1702997 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 157 | 520277 | 520540 | + | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 158 | 16229 | 16477 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 159 | 1345878 | 1346150 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 160 | 669798 | 670082 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 161 | 476331 | 476612 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 162 | 168193 | 168474 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 163 | 6218057 | 6218317 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 164 | 4872432 | 4872746 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 165 | 1965410 | 1965667 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 166 | 743207 | 743491 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 167 | 665431 | 665715 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 168 | 260052 | 260336 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 169 | 756972 | 757256 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 170 | 746999 | 747262 | - | NZ_CP007130.1 | Gemmatirosa kalamazoonesis |
| 171 | 87128 | 87403 | + | NZ_CP018787.1 | Oxalobacter formigenes |
| 172 | 154054 | 154338 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 173 | 860982 | 861257 | - | NZ_CP019239.1 | Rhodoferax saidenbachensis |
| 174 | 8007271 | 8007585 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 175 | 886483 | 886746 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 176 | 30071 | 30355 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 177 | 623316 | 623579 | - | NZ_CP035503.1 | Rhodoferax sediminis |
| 178 | 4438914 | 4439225 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 179 | 2176557 | 2176838 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 180 | 2146155 | 2146436 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 181 | 2177748 | 2178029 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 182 | 2654436 | 2654684 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 183 | 1889902 | 1890186 | - | NZ_CP038452.1 | Thermus caldilimi |
| 184 | 3135054 | 3135329 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 185 | 2289858 | 2290115 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 186 | 2841514 | 2841762 | - | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 187 | 1036151 | 1036435 | + | NZ_CP016312.1 | Thermus brockianus |
| 188 | 247140 | 247424 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 189 | 1878304 | 1878585 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 190 | 25325 | 25609 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 191 | 553780 | 554052 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 192 | 4944696 | 4944959 | + | NZ_CP013729.1 | Roseateles depolymerans |
| 193 | 4677574 | 4677855 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 194 | 4323992 | 4324255 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 195 | 297664 | 297927 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 196 | 432196 | 432483 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 197 | 2914010 | 2914294 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 198 | 551042 | 551326 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 199 | 463430 | 463693 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 200 | 664693 | 664959 | - | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 201 | 2300585 | 2300842 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 202 | 651973 | 652257 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 203 | 1754787 | 1755041 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 204 | 608254 | 608538 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 205 | 2116046 | 2116330 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 206 | 873372 | 873659 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 207 | 1532342 | 1532653 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 208 | 824176 | 824445 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 209 | 3676902 | 3677132 | + | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 210 | 684122 | 684376 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 211 | 2942997 | 2943290 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 212 | 1530374 | 1530637 | - | NZ_CP027666.1 | Ottowia oryzae |
| 213 | 564200 | 564481 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 214 | 724028 | 724315 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 215 | 621820 | 622128 | - | NC_013525.1 | Thermobaculum terrenum ATCC BAA-798 |
| 216 | 2427176 | 2427445 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 217 | 279083 | 279340 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 218 | 2569371 | 2569652 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 219 | 112920 | 113150 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 220 | 121696 | 121980 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 221 | 4272968 | 4273228 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 222 | 588979 | 589272 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 223 | 3256648 | 3256911 | - | NZ_CP029210.1 | Aquabacterium olei |
| 224 | 1293169 | 1293402 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 225 | 229479 | 229736 | + | NZ_CP025120.1 | Kangiella profundi |
| 226 | 1909196 | 1909483 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 227 | 871518 | 871799 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 228 | 3595439 | 3595720 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 229 | 580037 | 580321 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 230 | 1100075 | 1100350 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 231 | 911251 | 911526 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 232 | 2472818 | 2473108 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 233 | 2696606 | 2696890 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 234 | 2854186 | 2854458 | + | NZ_CP037953.1 | Permianibacter aggregans |
| 235 | 429008 | 429271 | - | NZ_CP012154.1 | Wenzhouxiangella marina |
| 236 | 2118320 | 2118577 | - | NZ_LT859958.1 | Brevefilum fermentans |
| 237 | 1974674 | 1974958 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 238 | 707265 | 707540 | + | NZ_CP011568.3 | Pandoraea thiooxydans |
| 239 | 1781050 | 1781322 | - | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 240 | 2006716 | 2007006 | - | NZ_CP008782.1 | Burkholderia pseudomallei |
| 241 | 4175916 | 4176191 | - | NZ_CP010897.2 | Pandoraea vervacti |
| 242 | 372122 | 372406 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 243 | 681155 | 681439 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 244 | 2771143 | 2771406 | - | NZ_CP026111.1 | Paraburkholderia terrae |
| 245 | 2952572 | 2952835 | + | NZ_CP015958.1 | Paraburkholderia caribensis |
| 246 | 593474 | 593755 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 247 | 1546077 | 1546352 | + | NZ_CP013481.2 | Pandoraea apista |
| 248 | 2209703 | 2209978 | + | NZ_CP047385.1 | Pandoraea fibrosis |
| 249 | 4165767 | 4166042 | - | NZ_CP011253.3 | Pandoraea oxalativorans |
| 250 | 1208451 | 1208726 | + | NZ_LT906435.1 | Pandoraea sputorum |
| 251 | 1273107 | 1273391 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 252 | 3842618 | 3842896 | + | NZ_CP013235.1 | Collimonas arenae |
| 253 | 3175934 | 3176200 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
| 254 | 4775252 | 4775530 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 255 | 4719657 | 4719935 | + | NZ_CP013236.1 | Collimonas pratensis |
| 256 | 266151 | 266414 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 257 | 2736600 | 2736893 | - | NZ_CP013480.3 | Pandoraea norimbergensis |
| 258 | 696408 | 696683 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 259 | 2075070 | 2075354 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 260 | 2338193 | 2338477 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 261 | 1758095 | 1758382 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 262 | 321754 | 322014 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 263 | 474690 | 474950 | - | NZ_CP036532.1 | Roseitalea porphyridii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP059276.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00118.26 | 1.0 | 259 | 46 | same-strand | TCP-1/cpn60 chaperonin family |
++ More..