Protein Information |
Information Type | Description |
---|---|
Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
NCBI Accession ID | CP000413.1 |
Organism | Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / AM63) |
Left | 1392346 |
Right | 1392621 |
Strand | + |
Nucleotide Sequence | ATGAAAACTGTCACAATGAAAGTTACCGGCCTTGTCCAAGGTGTTGGCTTTAGATGGACCACGCAAATGATTGCACAAGATTTAGGAATTACCGGAACTGTTAAAAATAATCCTGATGGATCAGTTTCTATTGTAGCTCAAGGGGAGGAGCTTCCTTTAGAACATTTTATTAAAAAAATTAAAGCTTCTCCTTCAGTAGCTGGACATGTAGATCATGTTGATTTAAATACAGTCTCTGATGCAGAAAAATTTACTCGCTTTAGTGTGGTTTATTGA |
Sequence | MKTVTMKVTGLVQGVGFRWTTQMIAQDLGITGTVKNNPDGSVSIVAQGEELPLEHFIKKIKASPSVAGHVDHVDLNTVSDAEKFTRFSVVY |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
Pubmed ID | 17030793 |
Domain | CDD:412440 |
Functional Category | Others |
Uniprot ID | Q041W5 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1392346 | 1392621 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
2 | 1435011 | 1435286 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
3 | 1442835 | 1443110 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
4 | 689344 | 689619 | - | NZ_CP023074.1 | Enterococcus thailandicus |
5 | 1998383 | 1998658 | + | NZ_CP018061.1 | Enterococcus mundtii |
6 | 1115303 | 1115578 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
7 | 220388 | 220666 | + | NZ_CP046037.1 | Latilactobacillus sakei |
8 | 1529746 | 1530021 | - | NZ_CP023011.2 | Enterococcus hirae |
9 | 779316 | 779591 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
10 | 2300311 | 2300589 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
11 | 677245 | 677517 | - | NZ_CP019981.1 | Pediococcus inopinatus |
12 | 1022510 | 1022791 | - | NZ_AP022822.1 | Enterococcus saigonensis |
13 | 2306444 | 2306728 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
14 | 2162610 | 2162867 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
15 | 1480852 | 1481127 | + | NZ_CP017194.1 | Lactococcus carnosus |
16 | 1558608 | 1558883 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
17 | 1380684 | 1380959 | + | NC_007796.1 | Methanospirillum hungatei JF-1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00588.21 | 0.94 | 16 | 104.0 | opposite-strand | SpoU rRNA Methylase family |
2 | PF08032.14 | 0.94 | 16 | 104.0 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
3 | PF02096.22 | 0.82 | 14 | 80.0 | same-strand | 60Kd inner membrane protein |