Result : Q03VS7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000414.1 |
| Organism | Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) |
| Left | 1606965 |
| Right | 1607189 |
| Strand | - |
| Nucleotide Sequence | ATGAGTGAACAACCCACATTTGAAGATAAGTTACAACAATTAGAAAGTATCGTGAGTCAGCTAGAAAAGGGTGATCGTCCCTTGGAAACCGCTTTGGCTGATTTTCAAACCGGTGTTGGTTTGGTCAAAGATTTACAAAAGACATTGAAGGATGCTGAAGATACATTGGCAAAGGTTATAGATAATGATGATGAATTATCAGATTTGGAATTAACTAATGATTGA |
| Sequence | MSEQPTFEDKLQQLESIVSQLEKGDRPLETALADFQTGVGLVKDLQKTLKDAEDTLAKVIDNDDELSDLELTND |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 17030793 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q03VS7 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 88
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 100037 | 100261 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 2 | 1564630 | 1564854 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 3 | 1669340 | 1669564 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 4 | 1211002 | 1211226 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 5 | 1441956 | 1442180 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 6 | 1374737 | 1374961 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 7 | 495898 | 496122 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 8 | 494963 | 495184 | + | NZ_CP061835.1 | Weissella viridescens |
| 9 | 1411093 | 1411323 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 10 | 1678676 | 1678906 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 11 | 1061676 | 1061906 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 12 | 2966387 | 2966635 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 13 | 825445 | 825681 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 14 | 882894 | 883082 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 15 | 1415908 | 1416123 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 16 | 1546976 | 1547194 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 17 | 1063175 | 1063420 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 18 | 2142868 | 2143059 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 19 | 639808 | 640032 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 20 | 1118995 | 1119210 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 21 | 280602 | 280820 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 22 | 509088 | 509303 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 23 | 1445122 | 1445352 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 24 | 604347 | 604538 | + | NZ_CP027563.1 | Weissella confusa |
| 25 | 865197 | 865433 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 26 | 1066253 | 1066486 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 27 | 1236834 | 1237061 | - | NZ_CP017326.1 | Weissella soli |
| 28 | 1178986 | 1179201 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 29 | 860852 | 861082 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 30 | 1034022 | 1034240 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 31 | 1244785 | 1245000 | + | NZ_LR134293.1 | Streptococcus canis |
| 32 | 2273948 | 2274178 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 33 | 1593302 | 1593493 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 34 | 927905 | 928141 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 35 | 1482454 | 1482672 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 36 | 1258228 | 1258419 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 37 | 184896 | 185111 | - | NZ_CP043405.1 | Streptococcus ratti |
| 38 | 1570591 | 1570818 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 39 | 1574744 | 1574968 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 40 | 544499 | 544693 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 41 | 1132471 | 1132686 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 42 | 1482556 | 1482771 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 43 | 704609 | 704842 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 44 | 261197 | 261415 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 45 | 1568259 | 1568474 | - | NC_012924.1 | Streptococcus suis SC84 |
| 46 | 1556789 | 1557010 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 47 | 2806111 | 2806305 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 48 | 2042174 | 2042368 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 49 | 1074633 | 1074854 | - | NZ_CP013237.1 | Streptococcus mutans |
| 50 | 515719 | 515901 | + | NZ_LS483343.1 | Streptococcus ferus |
| 51 | 2256545 | 2256757 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 52 | 187884 | 188096 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 53 | 549474 | 549689 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 54 | 1426448 | 1426663 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 55 | 1962306 | 1962530 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 56 | 2020000 | 2020224 | - | NZ_CP065211.1 | Enterococcus lactis |
| 57 | 714755 | 714988 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 58 | 1410966 | 1411178 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 59 | 571077 | 571259 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 60 | 1933406 | 1933618 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 61 | 207855 | 208043 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 62 | 1329241 | 1329447 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 63 | 1401216 | 1401422 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 64 | 1274351 | 1274566 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 65 | 1658051 | 1658290 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 66 | 501958 | 502173 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 67 | 910440 | 910661 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 68 | 691666 | 691866 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 69 | 67327 | 67545 | + | NZ_LT906439.1 | Streptococcus merionis |
| 70 | 2725708 | 2725932 | - | NZ_CP023011.2 | Enterococcus hirae |
| 71 | 1867332 | 1867529 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 72 | 956655 | 956867 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 73 | 1113848 | 1114060 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 74 | 1690905 | 1691129 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 75 | 572759 | 572986 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 76 | 3152395 | 3152595 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 77 | 1725820 | 1726059 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 78 | 1084583 | 1084795 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 79 | 1086064 | 1086267 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 80 | 3087493 | 3087693 | + | NZ_CP038853.1 | Pantoea vagans |
| 81 | 843994 | 844200 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 82 | 1474935 | 1475117 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 83 | 1398480 | 1398701 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 84 | 966005 | 966205 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 85 | 1255401 | 1255634 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 86 | 434615 | 434857 | - | NZ_CP028271.1 | Mixta intestinalis |
| 87 | 402515 | 402757 | + | NZ_CP019706.1 | Pantoea alhagi |
| 88 | 1195375 | 1195617 | - | NZ_CP061511.1 | Mixta calida |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP018180.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02601.17 | 0.92 | 81 | -7 | same-strand | Exonuclease VII, large subunit |
| 2 | PF13742.8 | 0.92 | 81 | -7 | same-strand | OB-fold nucleic acid binding domain |
| 3 | PF01728.21 | 0.92 | 81 | 868 | same-strand | FtsJ-like methyltransferase |
| 4 | PF01316.23 | 0.85 | 75 | 1716 | same-strand | Arginine repressor, DNA binding domain |
| 5 | PF02863.20 | 0.78 | 69 | 1724 | same-strand | Arginine repressor, C-terminal domain |
| 6 | PF13476.8 | 0.82 | 72 | 2171.5 | same-strand | AAA domain |
| 7 | PF01336.27 | 0.88 | 77 | -7 | same-strand | OB-fold nucleic acid binding domain |
| 8 | PF02882.21 | 0.61 | 54 | 1362.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 9 | PF00763.25 | 0.61 | 54 | 1362.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 10 | PF02463.21 | 0.84 | 74 | 2188 | same-strand | RecF/RecN/SMC N terminal domain |
| 11 | PF00348.19 | 0.85 | 75 | 0 | same-strand | Polyprenyl synthetase |
++ More..