Result : A6U8N5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000738.1 |
| Organism | Sinorhizobium medicae (strain WSM419) (Ensifer medicae) |
| Left | 1241855 |
| Right | 1242061 |
| Strand | + |
| Nucleotide Sequence | ATGGGTTCCTTTAGTATCTGGCACTGGTTGATCGTCCTTGCGGTGGTCCTGCTGCTGTTTGGCCGCGGCAAGATTCCGGAGTTGATGGGCGACGTTGCCAAGGGCATCAAGAACTTCAAGAAAGGCATGAGCGACGAAGACGCCGCTGCGGCCGATAAATCGATCGACGGCAAGACCGTCGACCACAAGTCTGACGAAGTCCGCTGA |
| Sequence | MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKKGMSDEDAAAADKSIDGKTVDHKSDEVR |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | A6U8N5 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 104
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1665680 | 1665886 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 2 | 1458572 | 1458778 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 3 | 1333387 | 1333593 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 4 | 1274659 | 1274865 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 5 | 1354371 | 1354577 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 6 | 1650936 | 1651142 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 7 | 1708061 | 1708267 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 8 | 2791187 | 2791396 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 9 | 6963048 | 6963269 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 10 | 3825106 | 3825327 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 11 | 3423685 | 3423906 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 12 | 4094654 | 4094875 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 13 | 3649512 | 3649733 | + | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 14 | 4146990 | 4147211 | + | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 15 | 907612 | 907833 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 16 | 429620 | 429835 | + | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 17 | 1309190 | 1309396 | - | NZ_CP053856.1 | Rhizobium pusense |
| 18 | 1310740 | 1310946 | - | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 19 | 3912480 | 3912683 | - | NZ_CP010803.1 | Martelella endophytica |
| 20 | 2905344 | 2905559 | + | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 21 | 2848183 | 2848395 | - | NZ_CP032509.1 | Georhizobium profundi |
| 22 | 1949634 | 1949870 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 23 | 1904592 | 1904783 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 24 | 2731060 | 2731281 | + | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 25 | 3177567 | 3177764 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 26 | 5196799 | 5197032 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 27 | 2481263 | 2481454 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 28 | 1037085 | 1037315 | + | NZ_CP064063.1 | Brucella anthropi |
| 29 | 5587351 | 5587587 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 30 | 1524279 | 1524470 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 31 | 6628198 | 6628431 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 32 | 3539645 | 3539878 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 33 | 1842530 | 1842724 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 34 | 3974827 | 3975060 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 35 | 4231299 | 4231532 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 36 | 5700543 | 5700776 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 37 | 3501145 | 3501378 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 38 | 6322942 | 6323175 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 39 | 1876231 | 1876422 | + | NZ_CP020906.1 | Rhizobium etli |
| 40 | 1924340 | 1924531 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 41 | 1929099 | 1929290 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 42 | 1437948 | 1438172 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 43 | 435560 | 435763 | - | NZ_CP046908.1 | Stappia indica |
| 44 | 604602 | 604793 | - | NZ_CP054021.1 | Rhizobium indicum |
| 45 | 1954724 | 1954915 | + | NZ_CP071604.1 | Rhizobium binae |
| 46 | 2197065 | 2197256 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 47 | 1261222 | 1261428 | + | NZ_CP010522.1 | Liberibacter crescens |
| 48 | 3763964 | 3764140 | + | NZ_CP071454.1 | Rhizobium lentis |
| 49 | 854245 | 854463 | + | NC_010103.1 | Brucella canis ATCC 23365 |
| 50 | 855875 | 856093 | + | NC_004310.3 | Brucella suis 1330 |
| 51 | 881106 | 881324 | + | NC_009505.1 | Brucella ovis ATCC 25840 |
| 52 | 860077 | 860295 | + | NC_013119.1 | Brucella microti CCM 4915 |
| 53 | 1129534 | 1129752 | - | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 54 | 1130649 | 1130867 | - | NC_022905.1 | Brucella ceti TE10759-12 |
| 55 | 873881 | 874099 | + | NC_007618.1 | Brucella abortus 2308 |
| 56 | 1853861 | 1854079 | - | NZ_LT605585.1 | Brucella inopinata |
| 57 | 1903405 | 1903608 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 58 | 1680148 | 1680339 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 59 | 1846362 | 1846601 | + | NZ_CP045423.1 | Microvirga thermotolerans |
| 60 | 4486432 | 4486653 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 61 | 1619421 | 1619627 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 62 | 1521172 | 1521378 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 63 | 904026 | 904259 | + | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 64 | 4954220 | 4954465 | + | NZ_CP016616.1 | Microvirga ossetica |
| 65 | 1616415 | 1616621 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 66 | 2152072 | 2152311 | - | NZ_CP036532.1 | Roseitalea porphyridii |
| 67 | 3083040 | 3083285 | - | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 68 | 2574173 | 2574391 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 69 | 1534667 | 1534894 | + | NZ_CP017940.1 | Phyllobacterium zundukense |
| 70 | 1418470 | 1418682 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 71 | 1987530 | 1987757 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 72 | 1424391 | 1424606 | - | NZ_CP059443.1 | Campylobacter fetus |
| 73 | 4167729 | 4167956 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 74 | 928213 | 928443 | + | NZ_CP054836.1 | Oricola thermophila |
| 75 | 1091851 | 1092087 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 76 | 808130 | 808312 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 77 | 1708801 | 1709016 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 78 | 1967791 | 1968009 | - | NC_014217.1 | Starkeya novella DSM 506 |
| 79 | 1990986 | 1991204 | + | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 80 | 1968267 | 1968446 | - | NZ_CP041025.1 | Paremcibacter congregatus |
| 81 | 236586 | 236798 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 82 | 2249878 | 2250111 | - | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 83 | 3774086 | 3774301 | - | NZ_CP044331.1 | Methylocystis parvus |
| 84 | 1496457 | 1496678 | - | NZ_CP012541.1 | Campylobacter concisus |
| 85 | 2816054 | 2816293 | - | NZ_CP053015.1 | Sphingomonas lacunae |
| 86 | 3225221 | 3225394 | + | NZ_CP040818.1 | Paraoceanicella profunda |
| 87 | 574852 | 575061 | + | NZ_CP013236.1 | Collimonas pratensis |
| 88 | 2790204 | 2790425 | + | NZ_CP034464.1 | Undibacterium parvum |
| 89 | 1528128 | 1528331 | - | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 90 | 4746082 | 4746291 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 91 | 4731134 | 4731337 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 92 | 1268277 | 1268462 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 93 | 2112686 | 2112916 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 94 | 2813377 | 2813607 | - | NC_014006.1 | Sphingobium japonicum UT26S |
| 95 | 48079 | 48252 | + | NZ_CP029356.1 | Azospirillum thermophilum |
| 96 | 2234094 | 2234297 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 97 | 2196800 | 2197012 | - | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 98 | 1634484 | 1634699 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 99 | 3183881 | 3184084 | + | NZ_CP053416.1 | Salmonella bongori |
| 100 | 2872704 | 2872907 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 101 | 1483820 | 1484035 | - | NZ_CP047165.1 | Pelistega ratti |
| 102 | 415986 | 416207 | + | NZ_AP018738.1 | Ferriphaselus amnicola |
| 103 | 490948 | 491142 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 104 | 2548524 | 2548703 | - | NZ_CP037933.1 | Flavobacterium nackdongense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013107.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05036.15 | 0.75 | 78 | 3008.0 | same-strand | SPOR domain |
| 2 | PF00933.23 | 0.73 | 76 | 1800.0 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
| 3 | PF02616.16 | 0.73 | 76 | 941.0 | same-strand | Segregation and condensation protein ScpA |
| 4 | PF04079.18 | 0.78 | 81 | 182 | same-strand | Segregation and condensation complex subunit ScpB |
| 5 | PF00902.20 | 0.89 | 93 | 678 | same-strand | Sec-independent protein translocase protein (TatC) |
| 6 | PF00587.27 | 0.76 | 79 | 1627 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 7 | PF02403.24 | 0.76 | 79 | 1627 | same-strand | Seryl-tRNA synthetase N-terminal domain |
| 8 | PF01975.19 | 0.72 | 75 | 3017 | same-strand | Survival protein SurE |
| 9 | PF01135.21 | 0.64 | 67 | 3781 | same-strand | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) |
++ More..