Result : Q03VF5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000414.1 |
| Organism | Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) |
| Left | 1699823 |
| Right | 1700095 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGCAATTGAAGTTGATGTTTTTGGTTTAGTACAAGGTGTTGGTTTTCGGTGGTTTGCACAACGAACTGCACAGCAACACAATATTGTTGGTTGGGTAAGTAACCAAACAGACGGTTCTGTTAAAATACATGCTCAGGGTTCACAAAGTGATTTAATAGATTTTTTGTCGGTGCTCGAGAAGGGGCCAGGCTTTTATAGTCGCGTTGACAAAGTTATCACAACAAATATTCCATTGTTTGAAACAAATGACTTTGCTATTCGTGGGTAA |
| Sequence | MKAIEVDVFGLVQGVGFRWFAQRTAQQHNIVGWVSNQTDGSVKIHAQGSQSDLIDFLSVLEKGPGFYSRVDKVITTNIPLFETNDFAIRG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 17030793 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q03VF5 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 51410 | 51682 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 2 | 1664811 | 1665083 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 3 | 1726875 | 1727147 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 4 | 1355198 | 1355464 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 5 | 1113503 | 1113751 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 6 | 1297113 | 1297340 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 7 | 846303 | 846575 | - | NZ_CP030775.1 | Clostridium butyricum |
| 8 | 1214393 | 1214665 | + | NZ_CP024610.1 | Lactobacillus terrae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028251.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13649.8 | 0.75 | 6 | 3611.5 | same-strand | Methyltransferase domain |
| 2 | PF13489.8 | 0.62 | 5 | 3608 | same-strand | Methyltransferase domain |
| 3 | PF08241.14 | 0.75 | 6 | 3611.5 | same-strand | Methyltransferase domain |
| 4 | PF08242.14 | 0.75 | 6 | 3611.5 | same-strand | Methyltransferase domain |
| 5 | PF05636.13 | 0.75 | 6 | 2441.0 | same-strand | HIGH Nucleotidyl Transferase |
| 6 | PF02620.19 | 0.88 | 7 | 1892 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 7 | PF00072.26 | 0.88 | 7 | 1101 | same-strand | Response regulator receiver domain |
| 8 | PF00486.30 | 0.88 | 7 | 1101 | same-strand | Transcriptional regulatory protein, C terminal |
| 9 | PF02518.28 | 0.88 | 7 | -13 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 10 | PF00512.27 | 0.88 | 7 | -13 | same-strand | His Kinase A (phospho-acceptor) domain |
| 11 | PF00672.27 | 0.88 | 7 | -13 | same-strand | HAMP domain |
| 12 | PF02096.22 | 0.88 | 7 | 62 | same-strand | 60Kd inner membrane protein |
| 13 | PF00588.21 | 0.88 | 7 | 1044 | same-strand | SpoU rRNA Methylase family |
| 14 | PF08032.14 | 0.88 | 7 | 1044 | same-strand | RNA 2'-O ribose methyltransferase substrate binding |
| 15 | PF03840.16 | 0.75 | 6 | 1905.5 | same-strand | Preprotein translocase SecG subunit |
| 16 | PF00773.21 | 0.75 | 6 | 2229.5 | same-strand | RNB domain |
| 17 | PF17876.3 | 0.75 | 6 | 2229.5 | same-strand | Cold shock domain |
| 18 | PF00575.25 | 0.75 | 6 | 2229.5 | same-strand | S1 RNA binding domain |
| 19 | PF08206.13 | 0.75 | 6 | 2229.5 | same-strand | Ribonuclease B OB domain |
| 20 | PF01668.20 | 0.75 | 6 | 4583.0 | same-strand | SmpB protein |
++ More..