Result : Q03RM5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000416.1 |
| Organism | Lactobacillus brevis (strain ATCC 367 / JCM 1170) |
| Left | 1031012 |
| Right | 1031284 |
| Strand | + |
| Nucleotide Sequence | ATGGAAACACAAAAAATTCTGGTCAGTGGTCAAGTGCAAGGCGTTGGGTTCCGCTGGTCGGCCACACGACTAGCCAAACAGCTGACGCTAACCGGTACTGTCCGCAATCTCGCTAACGGACAAGTTGAAATCATTGCCACTGGTGAATCTGCAACCCTACAACAATTCTGTCAGCAGCTCAAACATGGCTTATCCCCCTGGATTAACGTGATGACGCTGACAACCCACTCAATCCCAACCCACCAATTTGCCGACTTCCGGATTATTATTTGA |
| Sequence | METQKILVSGQVQGVGFRWSATRLAKQLTLTGTVRNLANGQVEIIATGESATLQQFCQQLKHGLSPWINVMTLTTHSIPTHQFADFRIII |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 17030793 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q03RM5 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1031682 | 1031954 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 2 | 3000655 | 3000927 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483405.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00072.26 | 1.0 | 2 | 3584.0 | opposite-strand | Response regulator receiver domain |
| 2 | PF00486.30 | 1.0 | 2 | 3584.0 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 3 | PF18719.3 | 1.0 | 2 | 1966.5 | opposite-strand | ArlS sensor domain |
| 4 | PF02518.28 | 1.0 | 2 | 1966.5 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 5 | PF00512.27 | 1.0 | 2 | 1966.5 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 6 | PF00672.27 | 1.0 | 2 | 1966.5 | opposite-strand | HAMP domain |
| 7 | PF06486.13 | 1.0 | 2 | 1353.5 | opposite-strand | Protein of unknown function (DUF1093) |
| 8 | PF02096.22 | 1.0 | 2 | 50.0 | same-strand | 60Kd inner membrane protein |
| 9 | PF00588.21 | 1.0 | 2 | 142.5 | opposite-strand | SpoU rRNA Methylase family |
| 10 | PF08032.14 | 1.0 | 2 | 142.5 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
| 11 | PF01966.24 | 1.0 | 2 | 1110.5 | opposite-strand | HD domain |
| 12 | PF01638.19 | 1.0 | 2 | 1643.0 | opposite-strand | HxlR-like helix-turn-helix |
| 13 | PF01409.22 | 1.0 | 2 | 2358.5 | opposite-strand | tRNA synthetases class II core domain (F) |
| 14 | PF02912.20 | 1.0 | 2 | 2358.5 | opposite-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 15 | PF17759.3 | 1.0 | 2 | 2886.5 | opposite-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
| 16 | PF03483.19 | 1.0 | 2 | 3414.5 | opposite-strand | B3/4 domain |
| 17 | PF03147.16 | 1.0 | 2 | 3414.5 | opposite-strand | Ferredoxin-fold anticodon binding domain |
| 18 | PF01588.22 | 1.0 | 2 | 3414.5 | opposite-strand | Putative tRNA binding domain |
| 19 | PF03484.17 | 1.0 | 2 | 3414.5 | opposite-strand | tRNA synthetase B5 domain |
++ More..