Protein Information |
Information Type | Description |
---|---|
Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
NCBI Accession ID | CP000416.1 |
Organism | Lactobacillus brevis (strain ATCC 367 / JCM 1170) |
Left | 1031012 |
Right | 1031284 |
Strand | + |
Nucleotide Sequence | ATGGAAACACAAAAAATTCTGGTCAGTGGTCAAGTGCAAGGCGTTGGGTTCCGCTGGTCGGCCACACGACTAGCCAAACAGCTGACGCTAACCGGTACTGTCCGCAATCTCGCTAACGGACAAGTTGAAATCATTGCCACTGGTGAATCTGCAACCCTACAACAATTCTGTCAGCAGCTCAAACATGGCTTATCCCCCTGGATTAACGTGATGACGCTGACAACCCACTCAATCCCAACCCACCAATTTGCCGACTTCCGGATTATTATTTGA |
Sequence | METQKILVSGQVQGVGFRWSATRLAKQLTLTGTVRNLANGQVEIIATGESATLQQFCQQLKHGLSPWINVMTLTTHSIPTHQFADFRIII |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
Pubmed ID | 17030793 |
Domain | CDD:412440 |
Functional Category | Others |
Uniprot ID | Q03RM5 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1031682 | 1031954 | - | NZ_LS483405.1 | Levilactobacillus brevis |
2 | 3000655 | 3000927 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00072.26 | 1.0 | 2 | 3584.0 | opposite-strand | Response regulator receiver domain |
2 | PF00486.30 | 1.0 | 2 | 3584.0 | opposite-strand | Transcriptional regulatory protein, C terminal |
3 | PF18719.3 | 1.0 | 2 | 1966.5 | opposite-strand | ArlS sensor domain |
4 | PF02518.28 | 1.0 | 2 | 1966.5 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
5 | PF00512.27 | 1.0 | 2 | 1966.5 | opposite-strand | His Kinase A (phospho-acceptor) domain |
6 | PF00672.27 | 1.0 | 2 | 1966.5 | opposite-strand | HAMP domain |
7 | PF06486.13 | 1.0 | 2 | 1353.5 | opposite-strand | Protein of unknown function (DUF1093) |
8 | PF02096.22 | 1.0 | 2 | 50.0 | same-strand | 60Kd inner membrane protein |
9 | PF00588.21 | 1.0 | 2 | 142.5 | opposite-strand | SpoU rRNA Methylase family |
10 | PF08032.14 | 1.0 | 2 | 142.5 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
11 | PF01966.24 | 1.0 | 2 | 1110.5 | opposite-strand | HD domain |
12 | PF01638.19 | 1.0 | 2 | 1643.0 | opposite-strand | HxlR-like helix-turn-helix |
13 | PF01409.22 | 1.0 | 2 | 2358.5 | opposite-strand | tRNA synthetases class II core domain (F) |
14 | PF02912.20 | 1.0 | 2 | 2358.5 | opposite-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
15 | PF17759.3 | 1.0 | 2 | 2886.5 | opposite-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
16 | PF03483.19 | 1.0 | 2 | 3414.5 | opposite-strand | B3/4 domain |
17 | PF03147.16 | 1.0 | 2 | 3414.5 | opposite-strand | Ferredoxin-fold anticodon binding domain |
18 | PF01588.22 | 1.0 | 2 | 3414.5 | opposite-strand | Putative tRNA binding domain |
19 | PF03484.17 | 1.0 | 2 | 3414.5 | opposite-strand | tRNA synthetase B5 domain |