Result : Q03QM3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0298 protein LVIS_1401 |
| NCBI Accession ID | CP000416.1 |
| Organism | Lactobacillus brevis (strain ATCC 367 / JCM 1170) |
| Left | 1369933 |
| Right | 1370220 |
| Strand | - |
| Nucleotide Sequence | ATGGCTTTTACGATTCAACCACGACAAAGTTTGATCGTGTATACGTATAGCTTAAAACAAACGCGACAGTTAAAGCGTTATGGTACAGTGATGTATGTCTCTAAAAAGATGCGTTATGTGGTCTTATATGTGAACCGAGAAGATGTAACGAAACTCACGGATCAACTGACCCATTTACGGTTTGTGAAGCGGGTGGTTGCTTCTTCACGGCCAACGATTAACGAGACGTTCAATGGTGTCGCCGCCGAAATGGTCACAACAACGGAAACCGAGGATGATGATGAATGA |
| Sequence | MAFTIQPRQSLIVYTYSLKQTRQLKRYGTVMYVSKKMRYVVLYVNREDVTKLTDQLTHLRFVKRVVASSRPTINETFNGVAAEMVTTTETEDDDE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
| Pubmed ID | 17030793 |
| Domain | CDD:420011 |
| Functional Category | Others |
| Uniprot ID | Q03QM3 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1431169 | 1431456 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 2 | 2569718 | 2570005 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 3 | 1795790 | 1796074 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 4 | 2090940 | 2091257 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483405.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12836.9 | 0.75 | 3 | 2235 | same-strand | Helix-hairpin-helix motif |
| 2 | PF00633.25 | 0.75 | 3 | 2235 | same-strand | Helix-hairpin-helix motif |
| 3 | PF13180.8 | 1.0 | 4 | 1044.0 | same-strand | PDZ domain |
| 4 | PF17820.3 | 0.75 | 3 | 1043 | same-strand | PDZ domain |
| 5 | PF01467.28 | 1.0 | 4 | 557.0 | same-strand | Cytidylyltransferase-like |
| 6 | PF03602.17 | 1.0 | 4 | -3.0 | same-strand | Conserved hypothetical protein 95 |
| 7 | PF01098.21 | 1.0 | 4 | 26.5 | same-strand | Cell cycle protein |
| 8 | PF00009.29 | 1.0 | 4 | 1334.5 | same-strand | Elongation factor Tu GTP binding domain |
| 9 | PF00679.26 | 1.0 | 4 | 1334.5 | same-strand | Elongation factor G C-terminus |
| 10 | PF03144.27 | 1.0 | 4 | 1334.5 | same-strand | Elongation factor Tu domain 2 |
| 11 | PF01926.25 | 1.0 | 4 | 1334.5 | same-strand | 50S ribosome-binding GTPase |
| 12 | PF00459.27 | 0.75 | 3 | 3312 | same-strand | Inositol monophosphatase family |
| 13 | PF05256.14 | 0.75 | 3 | 4110 | same-strand | Uncharacterised protein family (UPF0223) |
++ More..