Result : Q038C3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000423.1 |
| Organism | Lactobacillus paracasei (strain ATCC 334 / BCRC 17002 / CIP 107868 / KCTC 3260 / NRRL B-441) |
| Left | 1673304 |
| Right | 1673585 |
| Strand | + |
| Nucleotide Sequence | TTGGTCAAACTTGCTAAACAAATCGTCGTCCGCGGACGGGTGCAAGGCGTCGGTTTCCGCTGGGCCACGAAGATGATCGCCGACAATCTTGATATTAGCGGCACGATTGAGAATCGGTCTGATGGCTCTGTCTTTATTCAGGCTGCAGGTGAACCGTTAAACCTTGCCAAATTTGTGGCGAAGGTTAAGGCCGGTCCAAACCCATATGCAAACGTGTCGACCTACGAAGAACAGCCGCTTGAAGACGTGCCAAACTTCCGCGGTTTTCAAGTTACCGGTTGA |
| Sequence | MVKLAKQIVVRGRVQGVGFRWATKMIADNLDISGTIENRSDGSVFIQAAGEPLNLAKFVAKVKAGPNPYANVSTYEEQPLEDVPNFRGFQVTG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 17030793 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q038C3 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1630688 | 1630969 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 2 | 1611401 | 1611682 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 3 | 1612889 | 1613170 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 4 | 1115303 | 1115578 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 5 | 952095 | 952337 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 6 | 1834955 | 1835227 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 7 | 689344 | 689604 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 8 | 1318229 | 1318462 | - | NZ_LR134483.1 | Listeria grayi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014334.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01409.22 | 0.75 | 6 | 2424.5 | opposite-strand | tRNA synthetases class II core domain (F) |
| 2 | PF02912.20 | 0.75 | 6 | 2424.5 | opposite-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 3 | PF01638.19 | 0.75 | 6 | 1679.5 | opposite-strand | HxlR-like helix-turn-helix |
| 4 | PF01966.24 | 0.62 | 5 | 1045 | opposite-strand | HD domain |
| 5 | PF00588.21 | 0.88 | 7 | 167 | opposite-strand | SpoU rRNA Methylase family |
| 6 | PF08032.14 | 0.88 | 7 | 167 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
| 7 | PF02096.22 | 1.0 | 8 | 68.0 | same-strand | 60Kd inner membrane protein |
| 8 | PF18719.3 | 0.88 | 7 | 1352 | opposite-strand | ArlS sensor domain |
| 9 | PF02518.28 | 0.88 | 7 | 1352 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 10 | PF00512.27 | 0.88 | 7 | 1352 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 11 | PF00672.27 | 0.88 | 7 | 1352 | opposite-strand | HAMP domain |
| 12 | PF14501.8 | 0.75 | 6 | 1308.5 | opposite-strand | GHKL domain |
| 13 | PF00072.26 | 0.88 | 7 | 2878 | opposite-strand | Response regulator receiver domain |
| 14 | PF00486.30 | 0.88 | 7 | 2878 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 15 | PF00393.21 | 0.75 | 6 | 3870.0 | opposite-strand | 6-phosphogluconate dehydrogenase, C-terminal domain |
| 16 | PF03446.17 | 0.75 | 6 | 3870.0 | opposite-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
++ More..