Result : A6TR39
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000724.1 |
| Organism | Alkaliphilus metalliredigens (strain QYMF) |
| Left | 2543541 |
| Right | 2543768 |
| Strand | + |
| Nucleotide Sequence | TTGGCAAAAATCAAATTTGAAGAAGGTATTAAAAAATTAGAAGAAATTATTAATCAATTGGAGAACAAAGAACAAGGCTTAGATGATGCCCTTGAACTTTTTCAAGAAGGGGTACGATTGTATCGGATTTGTAACGAGAAACTAACAGAAGCTGAAGAAAAAATTTCAGTTATGATAGAAGAAGGCAATCAATTGGTTGAAAGACCTTTTGAGGGTGGGGAGGAATAA |
| Sequence | MAKIKFEEGIKKLEEIINQLENKEQGLDDALELFQEGVRLYRICNEKLTEAEEKISVMIEEGNQLVERPFEGGEE |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 27811105 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | A6TR39 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2543541 | 2543768 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 2 | 1918943 | 1919170 | + | NZ_CP009687.1 | Clostridium aceticum |
| 3 | 1449853 | 1450080 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009633.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12685.9 | 0.67 | 2 | 3380.5 | same-strand | SpoIIIAH-like protein |
| 2 | PF03780.15 | 0.67 | 2 | 2902.0 | same-strand | Asp23 family, cell envelope-related function |
| 3 | PF01029.20 | 1.0 | 3 | 2189 | same-strand | NusB family |
| 4 | PF00814.27 | 0.67 | 2 | 1245.5 | same-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
| 5 | PF13742.8 | 1.0 | 3 | -19 | same-strand | OB-fold nucleic acid binding domain |
| 6 | PF01336.27 | 1.0 | 3 | -19 | same-strand | OB-fold nucleic acid binding domain |
| 7 | PF00348.19 | 1.0 | 3 | 3 | same-strand | Polyprenyl synthetase |
| 8 | PF02681.16 | 0.67 | 2 | 907.0 | same-strand | Divergent PAP2 family |
| 9 | PF13292.8 | 1.0 | 3 | 2721 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 10 | PF02779.26 | 1.0 | 3 | 2721 | same-strand | Transketolase, pyrimidine binding domain |
| 11 | PF02780.22 | 1.0 | 3 | 2721 | same-strand | Transketolase, C-terminal domain |
| 12 | PF01728.21 | 1.0 | 3 | 4646 | same-strand | FtsJ-like methyltransferase |
| 13 | PF01479.27 | 1.0 | 3 | 4646 | same-strand | S4 domain |
++ More..