Result : Q031I3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0223 protein LACR_0546 |
| NCBI Accession ID | CP000425.1 |
| Organism | Lactococcus lactis subsp. cremoris (strain SK11) |
| Left | 512422 |
| Right | 512703 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGAAAATTATAATTACCCTCTTGATTTAAGTTGGAGTACTACTGAAATGACAGAAGTGCTCTCTTTTTTCAATCAAGTTGAGAAATTTTATGAAAGTAAAGTCGAAAAAGAGCTTTTTCTTGAGTCTTACGCTGCTTTCAAAAAAGTTGTTCCTTCAAAAATGCAGGAAAAACAATTGGGAAGAGATTTTGAGCAGAGCAGTGGTTACTCACTTTATCGTGCGCTCAAGGAGGTAGAAGCTAGTGGGAAACGATTTGTCAGTGCTGACAAGGCTTGA |
| Sequence | MKENYNYPLDLSWSTTEMTEVLSFFNQVEKFYESKVEKELFLESYAAFKKVVPSKMQEKQLGRDFEQSSGYSLYRALKEVEASGKRFVSADKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
| Pubmed ID | 17030793 |
| Domain | CDD:420035 |
| Functional Category | Others |
| Uniprot ID | Q031I3 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 67
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 495643 | 495924 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 643065 | 643346 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 16006 | 16281 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 4 | 1985648 | 1985929 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 5 | 991482 | 991760 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 6 | 792798 | 793025 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 7 | 1819907 | 1820185 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 8 | 219882 | 220160 | + | NZ_CP017194.1 | Lactococcus carnosus |
| 9 | 2000913 | 2001191 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 10 | 277332 | 277610 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 11 | 899270 | 899548 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 12 | 1083080 | 1083358 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 13 | 1030572 | 1030850 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 14 | 496800 | 497027 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 15 | 1040076 | 1040357 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 16 | 1290356 | 1290634 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 17 | 1334098 | 1334376 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 18 | 539547 | 539825 | + | NZ_CP013237.1 | Streptococcus mutans |
| 19 | 1091981 | 1092259 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 20 | 1310038 | 1310316 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 21 | 1125407 | 1125691 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 22 | 1074699 | 1074983 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 23 | 1581109 | 1581387 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 24 | 1001121 | 1001402 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 25 | 1851141 | 1851419 | - | NZ_CP043405.1 | Streptococcus ratti |
| 26 | 1190912 | 1191196 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 27 | 1066102 | 1066380 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 28 | 1393448 | 1393726 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 29 | 1179649 | 1179927 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 30 | 1217486 | 1217764 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 31 | 824159 | 824437 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 32 | 665745 | 665978 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 33 | 1059287 | 1059514 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 34 | 713859 | 714098 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 35 | 1767795 | 1768073 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 36 | 846345 | 846623 | + | NZ_LS483343.1 | Streptococcus ferus |
| 37 | 1705772 | 1706050 | - | NZ_LR134293.1 | Streptococcus canis |
| 38 | 1069554 | 1069832 | - | NC_012924.1 | Streptococcus suis SC84 |
| 39 | 1750174 | 1750404 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 40 | 901030 | 901260 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 41 | 2750218 | 2750499 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 42 | 949788 | 950069 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 43 | 923554 | 923832 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 44 | 598307 | 598585 | + | NZ_LT906439.1 | Streptococcus merionis |
| 45 | 1081467 | 1081709 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 46 | 519577 | 519822 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 47 | 2018870 | 2019118 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 48 | 1842390 | 1842617 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 49 | 912190 | 912438 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 50 | 673650 | 673883 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 51 | 2391700 | 2391987 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 52 | 751609 | 751890 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 53 | 1584612 | 1584842 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 54 | 1122435 | 1122683 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 55 | 1083691 | 1083918 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 56 | 1013506 | 1013736 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 57 | 990761 | 991042 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 58 | 2256719 | 2256946 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 59 | 1724024 | 1724251 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 60 | 449336 | 449569 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 61 | 1987347 | 1987619 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 62 | 1212424 | 1212705 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 63 | 1255748 | 1256029 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 64 | 1918698 | 1918928 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 65 | 1100712 | 1100939 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 66 | 689172 | 689399 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 67 | 1536470 | 1536739 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483383.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03960.17 | 0.63 | 42 | 2.0 | same-strand | ArsC family |
| 2 | PF00459.27 | 0.81 | 54 | -10.0 | same-strand | Inositol monophosphatase family |
| 3 | PF00528.24 | 0.63 | 42 | 3133.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
++ More..