Result : Q02YQ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0154 protein LACR_1404 |
| NCBI Accession ID | CP000425.1 |
| Organism | Lactococcus lactis subsp. cremoris (strain SK11) |
| Left | 1312930 |
| Right | 1313169 |
| Strand | - |
| Nucleotide Sequence | ATGAATTTAATCTTAGCTATTTTGCTTATGGTTGTATGCCTTTTGGCAGGTTTTTTCTTGGGAACATGGTTCTCACAACGCCAAACAAAAAAATTACTTATGGACAACCCACCCCTTAACGAAGATGCCGTTCGTCTTATGATGGGATCAATGGGACGCAAACCAAGTGAAGTTCAAGTGCAACAAGTTCTTCGTCAAATTCGTGCTGCTGCAAAGCAATCAGACACAAACAAAAAATAA |
| Sequence | MNLILAILLMVVCLLAGFFLGTWFSQRQTKKLLMDNPPLNEDAVRLMMGSMGRKPSEVQVQQVLRQIRAAAKQSDTNKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23791. Profile Description: Uncharacterized protein family (UPF0154). hypothetical protein; Provisional |
| Pubmed ID | 17030793 |
| Domain | CDD:420010 |
| Functional Category | Others |
| Uniprot ID | Q02YQ2 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1298787 | 1299026 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 904327 | 904566 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 3 | 1245316 | 1245555 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 4 | 1240657 | 1240896 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 5 | 1075362 | 1075598 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 6 | 1114966 | 1115202 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 7 | 2046859 | 2047095 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 8 | 1615659 | 1615895 | - | NC_012924.1 | Streptococcus suis SC84 |
| 9 | 1190725 | 1190973 | + | NZ_CP043405.1 | Streptococcus ratti |
| 10 | 7531 | 7779 | + | NZ_CP013237.1 | Streptococcus mutans |
| 11 | 419820 | 420068 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 12 | 1584211 | 1584447 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 13 | 229080 | 229316 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 14 | 1352728 | 1352964 | - | NZ_LT906439.1 | Streptococcus merionis |
| 15 | 1389254 | 1389502 | - | NZ_CP034543.1 | Streptococcus periodonticum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022369.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00571.30 | 1.0 | 15 | 2322 | same-strand | CBS domain |
| 2 | PF12850.9 | 1.0 | 15 | 1810 | same-strand | Calcineurin-like phosphoesterase superfamily domain |
| 3 | PF01725.18 | 1.0 | 15 | 945 | same-strand | Ham1 family |
| 4 | PF01177.24 | 1.0 | 15 | 132 | same-strand | Asp/Glu/Hydantoin racemase |
| 5 | PF02784.18 | 0.8 | 12 | 101.5 | same-strand | Pyridoxal-dependent decarboxylase, pyridoxal binding domain |
| 6 | PF00278.24 | 0.87 | 13 | 103 | same-strand | Pyridoxal-dependent decarboxylase, C-terminal sheet domain |
++ More..