ProsmORF-pred
Result : Q02X30
Protein Information
Information Type Description
Protein name UPF0213 protein LACR_2011
NCBI Accession ID CP000425.1
Organism Lactococcus lactis subsp. cremoris (strain SK11)
Left 1907377
Right 1907673
Strand +
Nucleotide Sequence ATGAACACCCATTTCACCTATGTTTTACAGTGCGCTGACCAAACGCTTTACTGTGGCTACACCACTGATTTAGAAAAAAGACTCGCCACTCACAACTCCGGAAAAGGAGCTAAATACACAAAAACGAGGCTTCCAGTTAAGTTACTTGCTTCTGTCAATTTTGATAATAAAAATGATGCCATGTCTTGTGAATGGTGGTTTAAACATAAACTTGTTCGTCAGCAAAAATTGAAACTTATCAAAAATAATTTGATTAAAGAAAAATTTTTAGAGTATCTTTTAGCCAAGCAAAAATAA
Sequence MNTHFTYVLQCADQTLYCGYTTDLEKRLATHNSGKGAKYTKTRLPVKLLASVNFDNKNDAMSCEWWFKHKLVRQQKLKLIKNNLIKEKFLEYLLAKQK
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues.
Pubmed ID 17030793
Domain CDD:417687
Functional Category Others
Uniprot ID Q02X30
ORF Length (Amino Acid) 98
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 104
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1965278 1965574 + NC_022369.1 Lactococcus lactis subsp. cremoris KW2
2 1742580 1742879 + NZ_CP070872.1 Lactococcus taiwanensis
3 903237 903536 - NZ_CP065637.1 Lactococcus garvieae
4 1513271 1513570 + NZ_CP032627.1 Lactococcus allomyrinae
5 2124578 2124817 - NZ_CP014835.1 Streptococcus halotolerans
6 1456158 1456397 + NZ_CP025536.1 Streptococcus pluranimalium
7 1465817 1466089 - NZ_CP054015.1 Streptococcus gallolyticus
8 583646 583891 - NZ_CP039457.1 Streptococcus pasteurianus
9 565826 566086 - NZ_LR594050.1 Streptococcus porcinus
10 690846 691106 + NZ_LR134341.1 Streptococcus pseudoporcinus
11 1530344 1530586 + NZ_LR134275.1 Streptococcus vestibularis
12 2338392 2338640 + NZ_CP068061.1 Mammaliicoccus vitulinus
13 547447 547701 - NZ_LS483343.1 Streptococcus ferus
14 2388113 2388361 - NZ_CP022046.2 Mammaliicoccus sciuri
15 1495078 1495320 + NC_012924.1 Streptococcus suis SC84
16 1273971 1274222 - NZ_LR134293.1 Streptococcus canis
17 2339117 2339365 - NZ_LT906462.1 Mammaliicoccus stepanovicii
18 1505032 1505301 + NC_017581.1 Streptococcus thermophilus JIM 8232
19 2310867 2311121 - NZ_CP054482.1 Macrococcus bohemicus
20 1937190 1937453 + NZ_CP032620.1 Streptococcus koreensis
21 631980 632225 - NZ_CP029491.1 Streptococcus sobrinus
22 2155550 2155816 - NZ_CP017195.1 Lactococcus paracarnosus
23 783475 783720 - NZ_LR134512.1 Streptococcus agalactiae
24 4788903 4789166 - NZ_CP010820.1 Lysinibacillus fusiformis
25 67694 67960 + NZ_CP017194.1 Lactococcus carnosus
26 1649933 1650172 + NZ_LR594049.1 Streptococcus gordonii
27 1305571 1305816 + NZ_LS483436.1 Streptococcus intermedius
28 2045902 2046150 + NC_014624.2 Eubacterium callanderi
29 3781065 3781313 + NZ_CP019962.1 Eubacterium limosum
30 682804 683052 + NZ_CP029487.1 Eubacterium maltosivorans
31 1387434 1387703 - NZ_LS483405.1 Levilactobacillus brevis
32 935672 935932 + NZ_CP053421.1 Pediococcus acidilactici
33 47894 48136 + NZ_LT603683.1 Bacillus glycinifermentans
34 232459 232704 + NC_022567.1 Adlercreutzia equolifaciens DSM 19450
35 65874 66137 + NZ_CP006837.1 Lysinibacillus varians
36 4655656 4655919 - NZ_CP019980.1 Lysinibacillus sphaericus
37 612538 612810 - NZ_AP018400.1 Streptococcus ruminantium
38 43721 43993 + NZ_CP059540.1 Planococcus maritimus
39 890222 890509 + NZ_CP047141.1 Ligilactobacillus animalis
40 1716667 1716936 - NZ_CP013661.2 Planococcus kocurii
41 874791 875078 + NC_008525.1 Pediococcus pentosaceus ATCC 25745
42 578911 579165 + NZ_CP032626.1 Apilactobacillus bombintestini
43 2226320 2226592 - NZ_LR134379.1 Slackia heliotrinireducens
44 1692407 1692661 - NZ_CP065729.1 Macrococcus caseolyticus
45 45936 46205 + NZ_CP019401.1 Planococcus faecalis
46 43821 44087 + NZ_CP016538.2 Planococcus maritimus
47 181574 181828 + NZ_CP045927.1 Staphylococcus agnetis
48 3886494 3886766 - NZ_CP011937.1 Bacillus velezensis
49 44782 45054 + NZ_CP053376.1 Bacillus amyloliquefaciens
50 39657 39896 + NZ_CP016540.2 Planococcus versutus
51 2712266 2712517 - NZ_CP011366.1 Salinicoccus halodurans
52 1472454 1472702 + NZ_CP020773.1 Staphylococcus lutrae
53 151689 151937 + NZ_LT906464.1 Staphylococcus muscae
54 2297531 2297785 - NZ_CP047361.1 Macrococcus canis
55 1805182 1805445 - NZ_CP015108.1 Sporosarcina ureae
56 46207 46476 + NZ_CP016534.2 Planococcus antarcticus DSM 14505
57 2316231 2316485 - NZ_CP008747.1 Staphylococcus hyicus
58 2626135 2626410 + NZ_CP012033.1 Levilactobacillus koreensis
59 1856657 1856905 - NZ_CP071463.1 Haloterrigena longa
60 1520937 1521200 - NZ_AP012544.1 Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393
61 2111362 2111616 - NZ_CP012294.1 Pediococcus damnosus
62 1338538 1338786 - NZ_CP031305.1 Natronorubrum bangense
63 1235608 1235856 - NZ_CP045488.1 Natronorubrum aibiense
64 822637 822900 + NZ_CP039139.1 Haloferax mediterranei ATCC 33500
65 1919402 1919683 - NC_008261.1 Clostridium perfringens ATCC 13124
66 169487 169735 + NC_014925.1 Staphylococcus pseudintermedius HKU10-03
67 44911 45150 + NZ_CP016537.2 Planococcus halocryophilus
68 1006434 1006679 + NZ_LT906446.1 Megamonas hypermegale
69 533011 533250 - NZ_LT906439.1 Streptococcus merionis
70 1323457 1323714 - NZ_LR134336.1 Streptococcus oralis ATCC 35037
71 65351 65620 + NZ_CP016543.2 Planococcus donghaensis
72 42125 42373 + NC_014729.1 Halogeometricum borinquense DSM 11551
73 3759285 3759533 - NC_019962.1 Natrinema pellirubrum DSM 15624
74 301683 301922 + NZ_CP027286.1 Clostridium chauvoei
75 673391 673636 - NZ_LS483383.1 Streptococcus cristatus ATCC 51100
76 2618370 2618636 + NC_012029.1 Halorubrum lacusprofundi ATCC 49239
77 2456869 2457120 - NZ_CP012395.1 Clostridium autoethanogenum DSM 10061
78 197612 197863 - NC_014328.1 Clostridium ljungdahlii DSM 13528
79 3472164 3472412 - NZ_CP040637.1 Natrinema pallidum
80 38154 38438 + NZ_CP023704.1 Caldibacillus thermoamylovorans
81 464519 464764 - NZ_CP027770.1 Staphylococcus felis
82 1523504 1523776 + NZ_CP047121.1 Lentilactobacillus hilgardii
83 2104497 2104742 - NZ_CP032757.1 Lactiplantibacillus pentosus
84 1618899 1619153 - NZ_CP058334.1 Natronomonas halophila
85 1399771 1400055 + NZ_CP017713.1 Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001
86 527615 527878 + NZ_CP016757.1 Cloacibacillus porcorum
87 1441051 1441314 - NC_015875.1 Streptococcus pseudopneumoniae IS7493
88 6101290 6101550 - NZ_CP022464.2 Enterocloster bolteae
89 2788711 2788968 - NZ_CP068053.1 Peribacillus psychrosaccharolyticus
90 1467978 1468229 - NZ_CP012559.1 Companilactobacillus heilongjiangensis
91 739495 739761 + NZ_CP049887.1 Vagococcus hydrophili
92 1525357 1525638 - NZ_LS991421.1 Lacticaseibacillus zeae
93 2073306 2073551 + NZ_CP023671.1 Clostridium septicum
94 297999 298259 + NZ_CP017253.2 Clostridium taeniosporum
95 757193 757444 + NC_015666.1 Halopiger xanaduensis SH-6
96 914993 915244 - NZ_CP071376.1 Clostridium gasigenes
97 2047149 2047412 + NZ_CP017267.1 Vagococcus teuberi
98 998993 999274 - NC_016605.1 Pediococcus claussenii ATCC BAA-344
99 171444 171692 + NZ_CP013911.1 Staphylococcus haemolyticus
100 1189498 1189785 + NZ_CP009498.1 Endomicrobium proavitum
101 636421 636669 - NZ_CP012034.1 Companilactobacillus ginsenosidimutans
102 2343317 2343571 - NZ_AP019004.1 Phascolarctobacterium faecium
103 1164331 1164594 - NZ_CP032621.1 Streptococcus gwangjuense
104 938769 939017 - NZ_CP059066.1 Koleobacter methoxysyntrophicus
105 1097392 1097673 - NZ_CP023011.2 Enterococcus hirae
++ More..