Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0346 protein LACR_2287 |
NCBI Accession ID | CP000425.1 |
Organism | Lactococcus lactis subsp. cremoris (strain SK11) |
Left | 2137970 |
Right | 2138179 |
Strand | - |
Nucleotide Sequence | ATGACATTTTATAATTACCTAATGCGCCATCGCGCACCAGTAGAGAAAGACGATGCGACTCGTCTTGCAAATCTTGTTTTTCAAGATCCACTTTTTCCGAAACAATCGAAAGATTTCGATGAAATTTCGACCTATTTAGAAACAGAAGCACCTTTTTATTTTAATCTCACCCTTTTTGACAATGTTTGGCTAAGTTATTTGGAAGCCTAA |
Sequence | MTFYNYLMRHRAPVEKDDATRLANLVFQDPLFPKQSKDFDEISTYLETEAPFYFNLTLFDNVWLSYLEA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
Pubmed ID | 17030793 |
Domain | CDD:416295 |
Functional Category | Others |
Uniprot ID | Q02WC9 |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2137274 | 2137483 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
2 | 1909336 | 1909545 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
3 | 1732265 | 1732453 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
4 | 617076 | 617264 | + | NZ_CP065637.1 | Lactococcus garvieae |
5 | 427950 | 428159 | + | NZ_CP017194.1 | Lactococcus carnosus |
6 | 1389206 | 1389415 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
7 | 444739 | 444948 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
8 | 467527 | 467715 | + | NZ_CP014699.1 | Streptococcus pantholopis |
9 | 2195195 | 2195401 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
10 | 1788467 | 1788655 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
11 | 1372785 | 1372973 | - | NZ_LR594050.1 | Streptococcus porcinus |
12 | 1324323 | 1324511 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
13 | 522263 | 522451 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
14 | 97408 | 97596 | + | NZ_CP014835.1 | Streptococcus halotolerans |
15 | 1814698 | 1814886 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01625.23 | 0.87 | 13 | 24 | same-strand | Peptide methionine sulfoxide reductase |
2 | PF17783.3 | 0.93 | 14 | 674.0 | same-strand | CvfB-like winged helix domain |
3 | PF13509.8 | 0.93 | 14 | 674.0 | same-strand | S1 domain |
4 | PF01765.21 | 0.87 | 13 | 1665 | same-strand | Ribosome recycling factor |
5 | PF00696.30 | 0.8 | 12 | 2321.5 | same-strand | Amino acid kinase family |