Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | CP000473.1 |
Organism | Solibacter usitatus (strain Ellin6076) |
Left | 1327464 |
Right | 1327763 |
Strand | - |
Nucleotide Sequence | GTGAAGATCACCGAAAAGGAAGTTCGCTACGTAGCCGGCCTGGCCAACCTCAATCTCACCGAGCAGGAGATCGCGCGCATGCAGGTCGATCTCGATGGCATTTTGGAGCACATGGCGCGGCTTAACGAAATCGACACCGAAGGCGTCGCGCCCATGTCGCAGGTGCTCTTCGAAGCCGAAGAGACCGCCACCTTGCGCCCCGATTCGCCCATTCCCCCGCTCGGCAATCAGGCCGCGATGGCCAATGCCCCGCAATCGGGCGCGGGCTATTTCAAAGTTCCCAAAGTCATCGAACGTTAA |
Sequence | MKITEKEVRYVAGLANLNLTEQEIARMQVDLDGILEHMARLNEIDTEGVAPMSQVLFEAEETATLRPDSPIPPLGNQAAMANAPQSGAGYFKVPKVIER |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | 19201974 |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | Q02A54 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 8728378 | 8728677 | - | NZ_CP063849.1 | Paludibaculum fermentans |
2 | 349591 | 349893 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
3 | 455926 | 456213 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 0.67 | 2 | 2705.5 | same-strand | ABC transporter |
2 | PF01425.23 | 1.0 | 3 | 43 | same-strand | Amidase |