ProsmORF-pred
Result : Q02A54
Protein Information
Information Type Description
Protein name Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-)
NCBI Accession ID CP000473.1
Organism Solibacter usitatus (strain Ellin6076)
Left 1327464
Right 1327763
Strand -
Nucleotide Sequence GTGAAGATCACCGAAAAGGAAGTTCGCTACGTAGCCGGCCTGGCCAACCTCAATCTCACCGAGCAGGAGATCGCGCGCATGCAGGTCGATCTCGATGGCATTTTGGAGCACATGGCGCGGCTTAACGAAATCGACACCGAAGGCGTCGCGCCCATGTCGCAGGTGCTCTTCGAAGCCGAAGAGACCGCCACCTTGCGCCCCGATTCGCCCATTCCCCCGCTCGGCAATCAGGCCGCGATGGCCAATGCCCCGCAATCGGGCGCGGGCTATTTCAAAGTTCCCAAAGTCATCGAACGTTAA
Sequence MKITEKEVRYVAGLANLNLTEQEIARMQVDLDGILEHMARLNEIDTEGVAPMSQVLFEAEETATLRPDSPIPPLGNQAAMANAPQSGAGYFKVPKVIER
Source of smORF Swiss-Prot
Function Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}.
Pubmed ID 19201974
Domain CDD:412411
Functional Category Others
Uniprot ID Q02A54
ORF Length (Amino Acid) 99
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 3
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 8728378 8728677 - NZ_CP063849.1 Paludibaculum fermentans
2 349591 349893 + NC_015064.1 Granulicella tundricola MP5ACTX9
3 455926 456213 + NZ_CP010311.1 Geoalkalibacter subterraneus
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP063849.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00005.29 0.67 2 2705.5 same-strand ABC transporter
2 PF01425.23 1.0 3 43 same-strand Amidase
++ More..