Result : Q022G5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L21 |
| NCBI Accession ID | CP000473.1 |
| Organism | Solibacter usitatus (strain Ellin6076) |
| Left | 4002639 |
| Right | 4002929 |
| Strand | + |
| Nucleotide Sequence | ATGCACGCGATCATCGAAACAGGCGGAAAGCAGTACCGGGTTGCTCCCGGTGATGTGATCCGCGTCGAAAAGCTGGCCGGCGATATCGGGTCGGAAATTGAGCTCCCTGTCAAGGCAGCGTTCAAAGAAGGCGGCGAGCTGGTGTCCGGGAAAGTCACGGGCACAATCGTTGGCGCCGACCGCGCAGCCAAAATTATCGTCTTCAAATTCAAGCGCAAGAAACAGTACAAGAAGACCATTGGACACCGCCAATCCTTCACCGATGTGAAGATCGGCGATGTGCTGGTTTAA |
| Sequence | MHAIIETGGKQYRVAPGDVIRVEKLAGDIGSEIELPVKAAFKEGGELVSGKVTGTIVGADRAAKIIVFKFKRKKQYKKTIGHRQSFTDVKIGDVLV |
| Source of smORF | Swiss-Prot |
| Function | This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000255|HAMAP-Rule:MF_01363}. |
| Pubmed ID | 19201974 |
| Domain | CDD:412347 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q022G5 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4220773 | 4221096 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 2 | 4078294 | 4078623 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 3 | 618264 | 618596 | - | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 4 | 535224 | 535556 | + | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 5 | 960947 | 961261 | + | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 6 | 3987710 | 3988021 | - | NZ_CP012333.1 | Labilithrix luteola |
| 7 | 5704608 | 5704940 | - | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 8 | 7079414 | 7079725 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 9 | 92922 | 93239 | - | NZ_CP042806.1 | Terriglobus albidus |
| 10 | 752712 | 753026 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 11 | 2154518 | 2154826 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 12 | 389942 | 390250 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 13 | 1277950 | 1278264 | + | NZ_CP040924.1 | Clostridium thermarum |
| 14 | 662300 | 662611 | + | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 15 | 4174384 | 4174689 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 16 | 2468 | 2776 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 17 | 1917518 | 1917829 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 18 | 5826342 | 5826653 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 19 | 928508 | 928819 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 20 | 11042849 | 11043157 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 21 | 626186 | 626494 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 22 | 834077 | 834388 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 23 | 315852 | 316163 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 24 | 4648431 | 4648739 | - | NZ_CP021434.1 | Tumebacillus avium |
| 25 | 95992 | 96306 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 26 | 986219 | 986530 | + | NZ_CP034118.1 | Staphylospora marina |
| 27 | 518358 | 518675 | - | NC_016024.1 | Chloracidobacterium thermophilum B |
| 28 | 467773 | 468084 | + | NZ_CP009761.1 | Parvimonas micra |
| 29 | 786979 | 787290 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01016.21 | 1.0 | 29 | 57 | same-strand | Ribosomal L27 protein |
| 2 | PF01926.25 | 0.62 | 18 | 665.0 | same-strand | 50S ribosome-binding GTPase |
++ More..