Result : Q01QR5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | CP000473.1 |
| Organism | Solibacter usitatus (strain Ellin6076) |
| Left | 8907613 |
| Right | 8907912 |
| Strand | - |
| Nucleotide Sequence | ATGGCGGAATCCAAAGGAAGACCGGGTAGCGCTTCACAGCGTCCCACCGGCGGCGACAAGGCGATCGCCGGACAGAAGAAACAGTATTTCCGGCGCAAGAAAGTCTGCCGGTTCTGCGTCGAGAAGATCGACGATATCAACTACAAGGACGTGAAGATGCTTCACGCCTTTGTTGCGGAGCGCGGCAAGATCGTCCCCCGCCGCATTTCCGGCGTGTGCGCCCCGCACCAGCGGCGCCTCACGGACGCGATCAAGAAGGCGCGCAACATCGCGCTGCTTCCGTTCGCGGCGTCGTTCTAA |
| Sequence | MAESKGRPGSASQRPTGGDKAIAGQKKQYFRRKKVCRFCVEKIDDINYKDVKMLHAFVAERGKIVPRRISGVCAPHQRRLTDAIKKARNIALLPFAASF |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 19201974 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q01QR5 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1853570 | 1853884 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 2 | 2420137 | 2420454 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 3 | 2790842 | 2791174 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 4 | 802928 | 803212 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 5 | 1686159 | 1686437 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 6 | 3192050 | 3192328 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 7 | 1731055 | 1731330 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 8 | 2951484 | 2951729 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 9 | 268331 | 268573 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 10 | 3056858 | 3057115 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 11 | 3929923 | 3930195 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 12 | 1241506 | 1241751 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 13 | 5924001 | 5924261 | - | NZ_CP043998.1 | Clostridium diolis |
| 14 | 4771692 | 4771979 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 15 | 6514802 | 6515062 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 16 | 1141767 | 1142078 | + | NZ_CP031518.1 | Treponema ruminis |
| 17 | 1054959 | 1055201 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 18 | 194235 | 194480 | + | NZ_CP014176.1 | Clostridium argentinense |
| 19 | 1753416 | 1753691 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 20 | 4744927 | 4745184 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 21 | 1615919 | 1616179 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 22 | 1709013 | 1709273 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 23 | 2029520 | 2029786 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 24 | 2286936 | 2287205 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 25 | 11946 | 12224 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 26 | 1499012 | 1499269 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 27 | 1116636 | 1116902 | - | NC_014217.1 | Starkeya novella DSM 506 |
| 28 | 5236789 | 5237037 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 29 | 5434274 | 5434522 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 30 | 3435564 | 3435833 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 31 | 1686398 | 1686649 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 32 | 1523001 | 1523273 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 33 | 307019 | 307282 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 34 | 434150 | 434395 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 35 | 3074961 | 3075272 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 36 | 1125158 | 1125433 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 37 | 3533495 | 3533758 | - | NZ_LR699011.1 | Roseburia hominis |
| 38 | 839399 | 839656 | - | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 39 | 650469 | 650750 | - | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014926.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03948.16 | 0.9 | 35 | 977 | same-strand | Ribosomal protein L9, C-terminal domain |
| 2 | PF01281.21 | 0.9 | 35 | 977 | same-strand | Ribosomal protein L9, N-terminal domain |
| 3 | PF01250.19 | 0.97 | 38 | 482.5 | same-strand | Ribosomal protein S6 |
| 4 | PF00436.27 | 0.62 | 24 | 26.5 | same-strand | Single-strand binding protein family |
++ More..