Protein Information |
Information Type | Description |
---|---|
Protein name | Yop proteins translocation protein F |
NCBI Accession ID | M74011.1 |
Organism | Yersinia enterocolitica |
Left | 4079 |
Right | 4342 |
Strand | + |
Nucleotide Sequence | ATGAGTAATTTCTCTGGGTTTACAAAAGGGAACGATATCGCTGACTTAGATGCGGTGGCTCAAACGCTCAAGAAGCCAGCAGACGACGCAAACAAGGCGGTTAATGACTCGATAGCAGCATTGAAAGATACGCCTGACAACCCGGCGTTACTTGCTGACTTACAACATTCAATTAATAAATGGTCGGTAATTTACAATATAAGCTCAACCATAGTTCGTAGCATGAAAGACTTAATGCAAGGCATCCTACAGAAGTTCCCATAA |
Sequence | MSNFSGFTKGNDIADLDAVAQTLKKPADDANKAVNDSIAALKDTPDNPALLADLQHSINKWSVIYNISSTIVRSMKDLMQGILQKFP |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl09641. Profile Description: Type III secretion needle MxiH, YscF, SsaG, EprI, PscF, EscF. type III secretion system needle protein SsaG; Provisional |
Pubmed ID | 1860816 |
Domain | CDD:415677 |
Functional Category | Others |
Uniprot ID | Q01247 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1184043 | 1184315 | - | NC_012962.1 | Photorhabdus asymbiotica |
2 | 3076913 | 3077176 | - | NZ_LR134376.1 | Aeromonas encheleia |
3 | 4447448 | 4447672 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
4 | 2145343 | 2145588 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
5 | 599643 | 599897 | + | NZ_CP011104.1 | Photorhabdus thracensis |
6 | 1862809 | 1863021 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
7 | 383748 | 384002 | - | NZ_CP062158.2 | Pseudomonas lundensis |
8 | 2012666 | 2012917 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
9 | 1060960 | 1061208 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
10 | 1395978 | 1396226 | + | NZ_CP009467.1 | Vibrio harveyi |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06578.14 | 1.0 | 10 | 1997.0 | same-strand | YOP proteins translocation protein K (YscK) |
2 | PF01514.19 | 1.0 | 10 | 1268.5 | same-strand | Secretory protein of YscJ/FliF family |
3 | PF17001.7 | 1.0 | 10 | 915.0 | same-strand | Type III secretion basal body protein I, YscI, HrpB, PscI |
4 | PF09025.12 | 0.8 | 8 | 350.0 | same-strand | YopR, type III needle-polymerisation regulator |
5 | PF09477.12 | 1.0 | 10 | 3.0 | same-strand | Bacterial type II secretion system chaperone protein (type III yscG) |
6 | PF08988.12 | 1.0 | 10 | 8.0 | same-strand | Type III secretion system, cytoplasmic E component of needle |
7 | PF16693.7 | 1.0 | 10 | 205.5 | same-strand | Inner membrane component of T3SS, periplasmic domain |
8 | PF16697.7 | 1.0 | 10 | 205.5 | same-strand | Inner membrane component of T3SS, cytoplasmic domain |
9 | PF00263.23 | 1.0 | 10 | 1485.0 | same-strand | Bacterial type II and III secretion system protein |
10 | PF03958.19 | 1.0 | 10 | 1485.0 | same-strand | Bacterial type II/III secretion system short domain |
11 | PF05932.15 | 0.9 | 9 | 3317 | same-strand | Tir chaperone protein (CesT) family |
12 | PF16806.7 | 1.0 | 10 | 3763.5 | same-strand | Antiactivator protein ExsD |