| Protein name |
Putative Yop proteins translocation protein E |
| NCBI Accession ID |
M74011.1 |
| Organism |
Yersinia enterocolitica |
| Left |
3878 |
| Right |
4078 |
| Strand |
+ |
| Nucleotide Sequence |
ATGACACAATTAGAGGAGCAACTGCATAACGTGGAGACAGTGCGCTCTATCACTATGCAACTAGAAATGGCGCTAGCGAAGCTCAAAAAAGATATGATGCGCGGTGGTGATGCCAAGCAGTATCAGGTTTGGCAGAGTGAATCTAAAGCTATTGAGTCAGCTATAGCCATTATTCATTATGTAGCAGGAGGTCTAAAATAA |
| Sequence |
MTQLEEQLHNVETVRSITMQLEMALAKLKKDMMRGGDAKQYQVWQSESKAIESAIAIIHYVAGGLK |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl27870. Profile Description: Type III secretion system, cytoplasmic E component of needle. Members of this family are found exclusively in type III secretion appparatus gene clusters in bacteria. Those bacteria with a protein from this family tend to target animal cells, as does Yersinia pestis. This protein is small (about 70 amino acids) and not well characterized. [Cellular processes, Pathogenesis] |
| Pubmed ID |
1860816
|
| Domain |
CDD:421555 |
| Functional Category |
Others |
| Uniprot ID |
Q01246
|
| ORF Length (Amino Acid) |
66 |