Protein name |
Putative Yop proteins translocation protein E |
NCBI Accession ID |
M74011.1 |
Organism |
Yersinia enterocolitica |
Left |
3878 |
Right |
4078 |
Strand |
+ |
Nucleotide Sequence |
ATGACACAATTAGAGGAGCAACTGCATAACGTGGAGACAGTGCGCTCTATCACTATGCAACTAGAAATGGCGCTAGCGAAGCTCAAAAAAGATATGATGCGCGGTGGTGATGCCAAGCAGTATCAGGTTTGGCAGAGTGAATCTAAAGCTATTGAGTCAGCTATAGCCATTATTCATTATGTAGCAGGAGGTCTAAAATAA |
Sequence |
MTQLEEQLHNVETVRSITMQLEMALAKLKKDMMRGGDAKQYQVWQSESKAIESAIAIIHYVAGGLK |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of cl27870. Profile Description: Type III secretion system, cytoplasmic E component of needle. Members of this family are found exclusively in type III secretion appparatus gene clusters in bacteria. Those bacteria with a protein from this family tend to target animal cells, as does Yersinia pestis. This protein is small (about 70 amino acids) and not well characterized. [Cellular processes, Pathogenesis] |
Pubmed ID |
1860816
|
Domain |
CDD:421555 |
Functional Category |
Others |
Uniprot ID |
Q01246
|
ORF Length (Amino Acid) |
66 |