Result : Q00829
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphatase RapA inhibitor (Phosphatase regulator A) |
| NCBI Accession ID | X56679.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1421 |
| Right | 1555 |
| Strand | + |
| Nucleotide Sequence | ATGAAATCTAAATGGATGTCAGGTTTGTTGCTCGTTGCGGTCGGGTTCAGCTTTACTCAGGTGATGGTTCATGCAGGTGAAACAGCAAACACAGAAGGGAAAACATTTCATATTGCGGCACGCAATCAAACATGA |
| Sequence | MKSKWMSGLLLVAVGFSFTQVMVHAGETANTEGKTFHIAARNQT |
| Source of smORF | Swiss-Prot |
| Function | Inhibitor of the activity of phosphatase RapA. |
| Pubmed ID | 1378051 9384377 |
| Domain | CDD:411379 |
| Functional Category | Others |
| Uniprot ID | Q00829 |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1316995 | 1317129 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1285452 | 1285586 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1290343 | 1290477 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 669243 | 669377 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1484697 | 1484831 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1324136 | 1324270 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1234551 | 1234688 | + | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04295.15 | 0.86 | 6 | 3558.5 | same-strand | D-galactarate dehydratase / Altronate hydrolase, C terminus |
| 2 | PF08666.14 | 0.86 | 6 | 3558.5 | same-strand | SAF domain |
| 3 | PF01925.21 | 1.0 | 7 | 3379 | opposite-strand | Sulfite exporter TauE/SafE |
| 4 | PF05163.14 | 1.0 | 7 | 2690 | opposite-strand | DinB family |
| 5 | PF12867.9 | 1.0 | 7 | 2690 | opposite-strand | DinB superfamily |
| 6 | PF18801.3 | 1.0 | 7 | -10 | same-strand | response regulator aspartate phosphatase H, N terminal |
| 7 | PF13424.8 | 1.0 | 7 | -10 | same-strand | Tetratricopeptide repeat |
| 8 | PF07719.19 | 1.0 | 7 | -10 | same-strand | Tetratricopeptide repeat |
| 9 | PF00515.30 | 1.0 | 7 | -10 | same-strand | Tetratricopeptide repeat |
| 10 | PF13176.8 | 1.0 | 7 | -10 | same-strand | Tetratricopeptide repeat |
| 11 | PF13181.8 | 1.0 | 7 | -10 | same-strand | Tetratricopeptide repeat |
| 12 | PF03795.16 | 0.71 | 5 | 32 | opposite-strand | YCII-related domain |
| 13 | PF01510.27 | 1.0 | 7 | 406 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 14 | PF01471.20 | 1.0 | 7 | 406 | same-strand | Putative peptidoglycan binding domain |
| 15 | PF01476.22 | 1.0 | 7 | 406 | same-strand | LysM domain |
| 16 | PF08000.13 | 0.71 | 5 | 1400 | opposite-strand | Bacterial PH domain |
| 17 | PF05908.13 | 1.0 | 7 | 1884 | same-strand | Poly-gamma-glutamate hydrolase |
| 18 | PF05067.14 | 0.86 | 6 | 2562.0 | same-strand | Manganese containing catalase |
++ More..