Result : Q00457
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Toluene-4-monooxygenase system, hydroxylase component subunit gamma (T4MO) (EC 1.14.13.236) (Toluene-4-monooxygenase hydroxylase subunit) (T4moH) (Toluene-4-monooxygenase system protein B) (T4moB) |
| NCBI Accession ID | M65106.1 |
| Organism | Pseudomonas mendocina |
| Left | 1558 |
| Right | 1812 |
| Strand | + |
| Nucleotide Sequence | ATGTCGGCATTTCCAGTTCACGCAGCGTTTGAAAAAGATTTCTTGGTTCAACTGGTAGTGGTGGATTTAAATGATTCCATGGACCAGGTAGCGGAGAAAGTTGCCTACCATTGTGTTAATCGTCGTGTTGCTCCTCGTGAAGGTGTCATGCGGGTTCGAAAGCATAGATCAACTGAGCTATTTCCACGGGATATGACCATAGCTGAGAGCGGCCTTAACCCAACTGAAGTGATCGATGTGGTATTCGAGGAGTAG |
| Sequence | MSAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE |
| Source of smORF | Swiss-Prot |
| Function | Component of the toluene-4-monooxygenase multicomponent enzyme system which catalyzes the O2- and NADH-dependent hydroxylation of toluene to form p-cresol (Pubmed:1885512, Pubmed:15240250, Pubmed:2019563, Pubmed:19290655, Pubmed:19705873). Also able to convert benzene to phenol, catechol, and 1,2,3-trihydroxybenzene by successive hydroxylations (Pubmed:15240250). {ECO:0000269|Pubmed:15240250, ECO:0000269|Pubmed:1885512, ECO:0000269|Pubmed:19290655, ECO:0000269|Pubmed:19705873, ECO:0000269|Pubmed:2019563}. |
| Pubmed ID | 1885512 15240250 2019563 19033467 19290655 19705873 22264099 25248368 28346937 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | Q00457 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 997828 | 998088 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 2 | 300311 | 300571 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 3 | 857652 | 857924 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008825.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00111.29 | 0.67 | 2 | 2567 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 2 | PF02332.20 | 1.0 | 3 | 702 | same-strand | Methane/Phenol/Toluene Hydroxylase |
| 3 | PF04945.15 | 0.67 | 2 | 62.0 | same-strand | YHS domain |
| 4 | PF00355.28 | 1.0 | 3 | 15 | same-strand | Rieske [2Fe-2S] domain |
| 5 | PF13806.8 | 1.0 | 3 | 15 | same-strand | Rieske-like [2Fe-2S] domain |
| 6 | PF02406.19 | 1.0 | 3 | 386 | same-strand | MmoB/DmpM family |
| 7 | PF00175.23 | 1.0 | 3 | 1992 | same-strand | Oxidoreductase NAD-binding domain |
| 8 | PF00970.26 | 0.67 | 2 | 1981.0 | same-strand | Oxidoreductase FAD-binding domain |
| 9 | PF08240.14 | 0.67 | 2 | 2345.0 | same-strand | Alcohol dehydrogenase GroES-like domain |
| 10 | PF00107.28 | 0.67 | 2 | 2345.0 | same-strand | Zinc-binding dehydrogenase |
++ More..